(data stored in ACNUC7421 zone)

EMBL: CP001630.PE556

CP001630.PE556       Location/Qualifiers
FT   CDS             612716..614470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AlkA domain protein; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: helix-turn-helix-
FT                   domain containing protein AraC type; KEGG: scl:sce6205
FT                   putative regulatory protein Ada"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34530"
FT                   /db_xref="GOA:C6WJ98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ98"
FT                   /inference="protein motif:PFAM:PF06029"
FT                   /protein_id="ACU34530.1"
FT                   /translation="MGAHAPADRHTTTHPPATDRPPATTGRATRGGAPTADRAPIGSRI
FT                   PTAGQPAAASRVPADASAPTTSRAATSHAGANAVAPAAGRTPVGRASADAGGPTAGRGA
FT                   AGRVPAAAGAPAASHAAASRASAGAGAPAAGRAAPGPAPAEVGAPATGHTTAPRPRAPH
FT                   PFADHPTAPPTTDLVDPTWGPRSDPVARALRMIVDGVVDREGVPGLATRLGYSVRQVER
FT                   RLLAELGSGPLAIARARRARTARLLAETTALPMTEIAVAAGFASVRAFNETVRELFGRS
FT                   PTDLRGGRRAPGGVPGAVVLRLPFRGPLHAPSLFGPLVANAVPGVEEWRDGAYRRTLRL
FT                   PRGHGVVSLRPRADHVECDLTLTDSRDLPVAISRCRRALDLDADPAEVDGALRADPALR
FT                   PLVDAAPGTRVPGVVDGAECAVRALLGEGTGTGAAMGAGANAGWAHRVVREAGEAVPDP
FT                   AGGGLTHLFPTPQALLDLDPALLPPPARAPLTALLTALVGGVDLGAGADRAEARSALRC
FT                   AGERVLDAVLTRSLGDPDGFCPDDPAVRAAAGGIGLPVTAAALADRSRAWRPWRAYATR
FT                   YLLGRAPT"
     MGAHAPADRH TTTHPPATDR PPATTGRATR GGAPTADRAP IGSRIPTAGQ PAAASRVPAD        60
     ASAPTTSRAA TSHAGANAVA PAAGRTPVGR ASADAGGPTA GRGAAGRVPA AAGAPAASHA       120
     AASRASAGAG APAAGRAAPG PAPAEVGAPA TGHTTAPRPR APHPFADHPT APPTTDLVDP       180
     TWGPRSDPVA RALRMIVDGV VDREGVPGLA TRLGYSVRQV ERRLLAELGS GPLAIARARR       240
     ARTARLLAET TALPMTEIAV AAGFASVRAF NETVRELFGR SPTDLRGGRR APGGVPGAVV       300
     LRLPFRGPLH APSLFGPLVA NAVPGVEEWR DGAYRRTLRL PRGHGVVSLR PRADHVECDL       360
     TLTDSRDLPV AISRCRRALD LDADPAEVDG ALRADPALRP LVDAAPGTRV PGVVDGAECA       420
     VRALLGEGTG TGAAMGAGAN AGWAHRVVRE AGEAVPDPAG GGLTHLFPTP QALLDLDPAL       480
     LPPPARAPLT ALLTALVGGV DLGAGADRAE ARSALRCAGE RVLDAVLTRS LGDPDGFCPD       540
     DPAVRAAAGG IGLPVTAAAL ADRSRAWRPW RAYATRYLLG RAPT                        584
//

If you have problems or comments...

PBIL Back to PBIL home page