(data stored in ACNUC7421 zone)

EMBL: CP001630.PE557

CP001630.PE557       Location/Qualifiers
FT   CDS             614627..614773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34531"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34531.1"
FT                   /translation="MDGDPPLSTDQLFSHLESHDAHFPVPASAEPSYEDLFHEPPATID
FT                   ASS"
     MDGDPPLSTD QLFSHLESHD AHFPVPASAE PSYEDLFHEP PATIDASS                     48
//

If you have problems or comments...

PBIL Back to PBIL home page