(data stored in ACNUC7421 zone)

EMBL: CP001630.PE558

CP001630.PE558       Location/Qualifiers
FT   CDS             complement(614904..615737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0565"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34532"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA0"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU34532.1"
FT                   /translation="MPALSPDAPAPVYIDTTKASIARVYDAFLNGKDNYEIDREVLRRV
FT                   QQVTPEAATLAVDNRGFLIRATRFLASQTGITQYLDCGSGLPTAENTHQVVQRLQPEAR
FT                   VVYVDNDPVVLAHGRALLEENDQTHFSAADIFDPEAILDDPVVREHIDFSKPVALLQLG
FT                   TMHHHNGTSPTSREIMAKYVDALPSGSFVALSHFLDPETEELSRLARRMEQAFLHSPMG
FT                   SGKFITRAELLGLFDGLELVEPGLVICADWWPDGPQLKELAPVSRCIAGAVGWKR"
     MPALSPDAPA PVYIDTTKAS IARVYDAFLN GKDNYEIDRE VLRRVQQVTP EAATLAVDNR        60
     GFLIRATRFL ASQTGITQYL DCGSGLPTAE NTHQVVQRLQ PEARVVYVDN DPVVLAHGRA       120
     LLEENDQTHF SAADIFDPEA ILDDPVVREH IDFSKPVALL QLGTMHHHNG TSPTSREIMA       180
     KYVDALPSGS FVALSHFLDP ETEELSRLAR RMEQAFLHSP MGSGKFITRA ELLGLFDGLE       240
     LVEPGLVICA DWWPDGPQLK ELAPVSRCIA GAVGWKR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page