(data stored in ACNUC7421 zone)

EMBL: CP001630.PE559

CP001630.PE559       Location/Qualifiers
FT   CDS             615946..616830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34533"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34533.1"
FT                   /translation="MATGEPRLPSGERDSGPTALRIVLGAQLRRLREAAEITRAQAGYQ
FT                   IRGSDSKISRLELGRVGLKERDVSDLLTMYGMVDEDARQKFLAMVRRSNEPGWWHRYTD
FT                   LMPDWFQDYVGLEEAATRILSYETHFVPGLLQTEDYARAIASHGRPELAGPEVQRRVTL
FT                   RMSRQKVLARPGAPRLWVVIDESVLHRPIGGRQVLLDQLDHLLEVTKQPLVTLQVVPFP
FT                   LSGYAAEGPFTMLRFGEPDLPDIVYVEHLAGALYLDKPEELEIYGRVFDRLTVDAETPD
FT                   RSRQALVKARAAL"
     MATGEPRLPS GERDSGPTAL RIVLGAQLRR LREAAEITRA QAGYQIRGSD SKISRLELGR        60
     VGLKERDVSD LLTMYGMVDE DARQKFLAMV RRSNEPGWWH RYTDLMPDWF QDYVGLEEAA       120
     TRILSYETHF VPGLLQTEDY ARAIASHGRP ELAGPEVQRR VTLRMSRQKV LARPGAPRLW       180
     VVIDESVLHR PIGGRQVLLD QLDHLLEVTK QPLVTLQVVP FPLSGYAAEG PFTMLRFGEP       240
     DLPDIVYVEH LAGALYLDKP EELEIYGRVF DRLTVDAETP DRSRQALVKA RAAL             294
//

If you have problems or comments...

PBIL Back to PBIL home page