(data stored in ACNUC7421 zone)

EMBL: CP001630.PE56

CP001630.PE56        Location/Qualifiers
FT   CDS             complement(64376..65581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4178 ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34030"
FT                   /db_xref="GOA:C6WDN5"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34030.1"
FT                   /translation="MNWQEELRKLDEELAAGRISADDYRTRRDQVLSSAQPAAQPAPPQ
FT                   EWQAQQPSGGPSNGPTGTSTGATQYIQPVNPDATQVVPGGGNRPGHNPDATQVVPGGGN
FT                   RPGDSDRTQVVPNGGMAPQYGQPSPAGGFPQPGAFGGPQQGGGMPPWQGGGGDTSAPWA
FT                   SSSSDNWLRQGPEVFDEGSSGGGKKVFAIIGVVLVVALIGGAVWFFGFKGSGDDSAKGG
FT                   DTPAPQSSTSAPTTTTTKAPIDLLPDPPGTPSTNNGTVELARAVEEKLLSADEAAAVEE
FT                   AAVKEVAFVGSTQDAFTYDAMVFEVGDEAKAEALVEGLVAAQGKTGMVDGAKGQLPAQS
FT                   TVQQLIRQGEPGIYRAIYAAGDKVVRVSTTQTPIAPGPNDQELIKKFQEFGIGVAKQFP
FT                   TS"
     MNWQEELRKL DEELAAGRIS ADDYRTRRDQ VLSSAQPAAQ PAPPQEWQAQ QPSGGPSNGP        60
     TGTSTGATQY IQPVNPDATQ VVPGGGNRPG HNPDATQVVP GGGNRPGDSD RTQVVPNGGM       120
     APQYGQPSPA GGFPQPGAFG GPQQGGGMPP WQGGGGDTSA PWASSSSDNW LRQGPEVFDE       180
     GSSGGGKKVF AIIGVVLVVA LIGGAVWFFG FKGSGDDSAK GGDTPAPQSS TSAPTTTTTK       240
     APIDLLPDPP GTPSTNNGTV ELARAVEEKL LSADEAAAVE EAAVKEVAFV GSTQDAFTYD       300
     AMVFEVGDEA KAEALVEGLV AAQGKTGMVD GAKGQLPAQS TVQQLIRQGE PGIYRAIYAA       360
     GDKVVRVSTT QTPIAPGPND QELIKKFQEF GIGVAKQFPT S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page