(data stored in ACNUC7421 zone)

EMBL: CP001630.PE560

CP001630.PE560       Location/Qualifiers
FT   CDS             616934..617221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0567"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34534"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA2"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU34534.1"
FT                   /translation="MHVQMHCLRSFGPKGWSMASRVHNGMSAASLQGVVWRKSARSGAL
FT                   GNCVELAHVDGGIAVRNSRFPDGPALVYTREEVAAFVAGAKDGEFDDLLG"
     MHVQMHCLRS FGPKGWSMAS RVHNGMSAAS LQGVVWRKSA RSGALGNCVE LAHVDGGIAV        60
     RNSRFPDGPA LVYTREEVAA FVAGAKDGEF DDLLG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page