(data stored in ACNUC7421 zone)

EMBL: CP001630.PE561

CP001630.PE561       Location/Qualifiers
FT   CDS             617205..617510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34535"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34535.1"
FT                   /translation="MTSSADQGGRTAGQLRQLIARGFQFLHPRDARGELAAVVGVRAHH
FT                   TVIDVVRLHDADNAVATRMPADESNVLFPSRFSWRSRGSATAVLEELLELPDDRMT"
     MTSSADQGGR TAGQLRQLIA RGFQFLHPRD ARGELAAVVG VRAHHTVIDV VRLHDADNAV        60
     ATRMPADESN VLFPSRFSWR SRGSATAVLE ELLELPDDRM T                           101
//

If you have problems or comments...

PBIL Back to PBIL home page