(data stored in ACNUC7421 zone)

EMBL: CP001630.PE562

CP001630.PE562       Location/Qualifiers
FT   CDS             complement(617909..619162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0569"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: hypothetical LOC586091"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34536"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA4"
FT                   /inference="protein motif:COG:COG2951"
FT                   /protein_id="ACU34536.1"
FT                   /translation="MAVEDSDGLTPAATPESPPRGREADRAAGAEPAPPATTGAKGIPV
FT                   NVLEAYREAERSLAGSCNLRWYHLAGIGKVESGHARGGRADPAGETAPQILGPVLDGGE
FT                   FAAIRDTDGGRHDGDRTWDRAVGPMQFIPSTWQRYAADGNGDGASSPHNIHDSAVAAGK
FT                   YLCSGGMDLAKQSDLDAAVFRYNHSRTYVVAVETWMRAYSDGAVEVPALPPGADEDEGG
FT                   SDGGKPEGAGASGESSSTAPESAAPESASEAAASEAAAAESAAADSSAPGSSAPDSSAP
FT                   DSSAPDSSAPDSSAPDSSAPGSAGSPAPDQQAPAAPDAVGANPQGQAVQGGQAANSAPQ
FT                   QAGAPPVETKRPAAPEPQQVDRCLVLVQEHAQASRPVAPTADEVRQAGCTAEQVAAIER
FT                   LFELSTPVDSPVEKSARE"
     MAVEDSDGLT PAATPESPPR GREADRAAGA EPAPPATTGA KGIPVNVLEA YREAERSLAG        60
     SCNLRWYHLA GIGKVESGHA RGGRADPAGE TAPQILGPVL DGGEFAAIRD TDGGRHDGDR       120
     TWDRAVGPMQ FIPSTWQRYA ADGNGDGASS PHNIHDSAVA AGKYLCSGGM DLAKQSDLDA       180
     AVFRYNHSRT YVVAVETWMR AYSDGAVEVP ALPPGADEDE GGSDGGKPEG AGASGESSST       240
     APESAAPESA SEAAASEAAA AESAAADSSA PGSSAPDSSA PDSSAPDSSA PDSSAPDSSA       300
     PGSAGSPAPD QQAPAAPDAV GANPQGQAVQ GGQAANSAPQ QAGAPPVETK RPAAPEPQQV       360
     DRCLVLVQEH AQASRPVAPT ADEVRQAGCT AEQVAAIERL FELSTPVDSP VEKSARE          417
//

If you have problems or comments...

PBIL Back to PBIL home page