(data stored in ACNUC7421 zone)

EMBL: CP001630.PE563

CP001630.PE563       Location/Qualifiers
FT   CDS             619562..625705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0570"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; LPXTG-
FT                   motif cell wall anchor domain protein; PFAM: Cna B domain
FT                   protein; Pericardin like; KEGG: gme:Gmet_2043 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34537"
FT                   /db_xref="GOA:C6WJA5"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA5"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACU34537.1"
FT                   /translation="MPEIGMARRLTAAMISTGLALGGTLVATGVAEATVVTNFTPVYEK
FT                   SVYGDFVQTGNGNMGCPTGADPASLNSLSFTDCVTAQGGTATGNNGRESHYMKYVDADG
FT                   GGNVATYNSSIAKVNIPAGATIDYARLHWGGNTGVFRNATDATGNRGCAPGYTSSASTF
FT                   PAGNPATAQISMAIGAGTPLTIGPDSYVADDAPTLVQNEAQQYVAWTDVKSLLGPAVTG
FT                   SDVNLTIGNIWTPQGYGCHAGWSLTAVYALPNPTGGAIKRSIQIKNGYVKQHASEGNYT
FT                   TSLETLDGASKTTGSRLGVTAFGGHQNLTSDALSYKGTALTEPRLNNSTNFFASTATNQ
FT                   VTPSVVNNFSVDAKVAVPTNVAVGDRSGAVVVGSGSDTFVLSSLAMSVPTPGIYITATP
FT                   RTTPPYYQGDSVIYDVVVGTSDNQTITNVGVSNTDQAFGDCNRPSTATLTSGNPTLSYS
FT                   CTVPAGTANFNNTIQAVGANAFLEPVSDSKTITATVSTIGLSLTKTADKATYSAGETIT
FT                   FTVTAANTGNTALTNVAIADAKVNACAKNQATLAAGAQLVSTCTATAPIAGDANTATVS
FT                   ATDARGGTVNNTATANAYSEGAISGRVFADRDDNGAFDAPMGDTNLVNVGISLTGTETN
FT                   GGAPVSLNTVTAPDGTWSFANLKAGNYTVTKDPTPDYDPGKRTPGNAATAPLNTETFTV
FT                   ALPGGQSSTGNLFAVIPTSSLSGFVYEDSNNNGVKDTGEKGIQGVAIALSGIDDGGNAA
FT                   NWNTSTDVDGAYTFKALRQGNYNLSETQPAGWTDGKDTPGSAGGTRDAPDSIVNIQLDP
FT                   RVTAIDYLFGEYKGTSIAGKVVDDKDMGIAGVKLTVTGGAGPLEATTDAGGAFSFTLAP
FT                   GTYTLTEEQPLGYAQGTDTVGTTGGTHSAENTFSAIVLKSGDAGTGYVFKEKRGSLTGY
FT                   VYEDKNGNGNKDAAEPGIANVSVKMTGTDAMSRPVNTTMTTNSQGLYTFAGVVGGTYSL
FT                   TETQPEGYENGVDKAGTVGGDYTPPDTISDISFPAGADATGYLFGEYKFGSIYGEVLND
FT                   KGNPIANVKITLENDERAPIGQMTMTDEFGQFVFEDIVPGTYKLVEEQPAGYADGPDTA
FT                   GTGGGDTSVADTIGLIPVGSGDILTGYQFTEKRGSLAGYVYEDTNNNGLKDTGEKGIQG
FT                   TELTLTGTDAQGKAVNLTATTDAAGLYKIEFIVGGTGYTLSEKQPAGYVTGKNKVGSQG
FT                   GTLTAPDKVTGITFSAGAAATGYLFGELTPASLAGDVVNEKGEGIAGVTVVLTGTDDMS
FT                   TTVNKSAVTTAGGKYAFNSLRPGTYNVTETQPDGYGQGTATPGSAGGTALGADEITGVV
FT                   ITSEAKATGYRFSEKRGSLSGVVFDDRDNDGVRDDGEPGIQGVTLTLKGNSEWCAVGEP
FT                   DGTDTETDNGTGTPTPDTGTDPGTGTDPGTGTDPGTGTDPGTGTDPGTGTDPGTGTDPG
FT                   TGTDPGTGTDPGTGTDPGTGTDTGTDPGTGSGGTPDTGVGAGGTPDTGGGRVDPTDATA
FT                   DATTADGEMTTMADPAVSAGDAAPTCAVTLTATTDASGVFSFAGLVGGTYDLMETQPAA
FT                   YADGKDTAGTAGGTVTAPDAIMGIVLAGGVDATGYLFGERAGVITGTVWVDANGDGKID
FT                   TTELGRIAGAKVDLMQGDSTTPLASATTTTEGTYEFKDVPAGDYSLMLTLPMGYGATTP
FT                   TTVKVTTTTTSGTNVDFGVQKGAIGDFVWDDLNRNGLQDAGEPGIAGVKVNLLDEQGEV
FT                   KSSTTTNASGKYMFGDLDEGTYRVQFTVPTGRTFTAQNAGAPEKSSAVDRSNGLSGPIV
FT                   FKVADSKVMQNMNVDAGVVDRITDLGVTLTADNPSPQVGSQVVITSKVVNTGTVPVNGA
FT                   IATITIPQGLTINGVDGGAPQAQGVAMARAARADEGWTCAVNGQQVVCTTPDVIQPGAS
FT                   SLPITITTTANSAFTTTNATALVTLADGTGDDNPANDGATTPALSTETPSTGGPNTGGG
FT                   TTQQPMPPMPPNGMGNMPLAWTGSEIRPVLIGGLALLLAGLGTLFLGKRRRKQGM"
     MPEIGMARRL TAAMISTGLA LGGTLVATGV AEATVVTNFT PVYEKSVYGD FVQTGNGNMG        60
     CPTGADPASL NSLSFTDCVT AQGGTATGNN GRESHYMKYV DADGGGNVAT YNSSIAKVNI       120
     PAGATIDYAR LHWGGNTGVF RNATDATGNR GCAPGYTSSA STFPAGNPAT AQISMAIGAG       180
     TPLTIGPDSY VADDAPTLVQ NEAQQYVAWT DVKSLLGPAV TGSDVNLTIG NIWTPQGYGC       240
     HAGWSLTAVY ALPNPTGGAI KRSIQIKNGY VKQHASEGNY TTSLETLDGA SKTTGSRLGV       300
     TAFGGHQNLT SDALSYKGTA LTEPRLNNST NFFASTATNQ VTPSVVNNFS VDAKVAVPTN       360
     VAVGDRSGAV VVGSGSDTFV LSSLAMSVPT PGIYITATPR TTPPYYQGDS VIYDVVVGTS       420
     DNQTITNVGV SNTDQAFGDC NRPSTATLTS GNPTLSYSCT VPAGTANFNN TIQAVGANAF       480
     LEPVSDSKTI TATVSTIGLS LTKTADKATY SAGETITFTV TAANTGNTAL TNVAIADAKV       540
     NACAKNQATL AAGAQLVSTC TATAPIAGDA NTATVSATDA RGGTVNNTAT ANAYSEGAIS       600
     GRVFADRDDN GAFDAPMGDT NLVNVGISLT GTETNGGAPV SLNTVTAPDG TWSFANLKAG       660
     NYTVTKDPTP DYDPGKRTPG NAATAPLNTE TFTVALPGGQ SSTGNLFAVI PTSSLSGFVY       720
     EDSNNNGVKD TGEKGIQGVA IALSGIDDGG NAANWNTSTD VDGAYTFKAL RQGNYNLSET       780
     QPAGWTDGKD TPGSAGGTRD APDSIVNIQL DPRVTAIDYL FGEYKGTSIA GKVVDDKDMG       840
     IAGVKLTVTG GAGPLEATTD AGGAFSFTLA PGTYTLTEEQ PLGYAQGTDT VGTTGGTHSA       900
     ENTFSAIVLK SGDAGTGYVF KEKRGSLTGY VYEDKNGNGN KDAAEPGIAN VSVKMTGTDA       960
     MSRPVNTTMT TNSQGLYTFA GVVGGTYSLT ETQPEGYENG VDKAGTVGGD YTPPDTISDI      1020
     SFPAGADATG YLFGEYKFGS IYGEVLNDKG NPIANVKITL ENDERAPIGQ MTMTDEFGQF      1080
     VFEDIVPGTY KLVEEQPAGY ADGPDTAGTG GGDTSVADTI GLIPVGSGDI LTGYQFTEKR      1140
     GSLAGYVYED TNNNGLKDTG EKGIQGTELT LTGTDAQGKA VNLTATTDAA GLYKIEFIVG      1200
     GTGYTLSEKQ PAGYVTGKNK VGSQGGTLTA PDKVTGITFS AGAAATGYLF GELTPASLAG      1260
     DVVNEKGEGI AGVTVVLTGT DDMSTTVNKS AVTTAGGKYA FNSLRPGTYN VTETQPDGYG      1320
     QGTATPGSAG GTALGADEIT GVVITSEAKA TGYRFSEKRG SLSGVVFDDR DNDGVRDDGE      1380
     PGIQGVTLTL KGNSEWCAVG EPDGTDTETD NGTGTPTPDT GTDPGTGTDP GTGTDPGTGT      1440
     DPGTGTDPGT GTDPGTGTDP GTGTDPGTGT DPGTGTDPGT GTDTGTDPGT GSGGTPDTGV      1500
     GAGGTPDTGG GRVDPTDATA DATTADGEMT TMADPAVSAG DAAPTCAVTL TATTDASGVF      1560
     SFAGLVGGTY DLMETQPAAY ADGKDTAGTA GGTVTAPDAI MGIVLAGGVD ATGYLFGERA      1620
     GVITGTVWVD ANGDGKIDTT ELGRIAGAKV DLMQGDSTTP LASATTTTEG TYEFKDVPAG      1680
     DYSLMLTLPM GYGATTPTTV KVTTTTTSGT NVDFGVQKGA IGDFVWDDLN RNGLQDAGEP      1740
     GIAGVKVNLL DEQGEVKSST TTNASGKYMF GDLDEGTYRV QFTVPTGRTF TAQNAGAPEK      1800
     SSAVDRSNGL SGPIVFKVAD SKVMQNMNVD AGVVDRITDL GVTLTADNPS PQVGSQVVIT      1860
     SKVVNTGTVP VNGAIATITI PQGLTINGVD GGAPQAQGVA MARAARADEG WTCAVNGQQV      1920
     VCTTPDVIQP GASSLPITIT TTANSAFTTT NATALVTLAD GTGDDNPAND GATTPALSTE      1980
     TPSTGGPNTG GGTTQQPMPP MPPNGMGNMP LAWTGSEIRP VLIGGLALLL AGLGTLFLGK      2040
     RRRKQGM                                                                2047
//

If you have problems or comments...

PBIL Back to PBIL home page