(data stored in ACNUC7421 zone)

EMBL: CP001630.PE564

CP001630.PE564       Location/Qualifiers
FT   CDS             626473..631002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0572"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: rso:RS05482
FT                   putative rhs-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34538"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA6"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACU34538.1"
FT                   /translation="MDNPLVAAPRSDTTAVTGIGIAESSVDLANGIADGNWVEAGLGGA
FT                   GVGLEVLSMVIDPVGTVASYGVGWLMEHVQPLKEALDWLAGDPPVIRSFSETWGNVAAE
FT                   VRAVAEELGGQDAPGWEGAAAQAFRGANAETADAIAGAGVLAEGVGIGVMVMGEVVAAV
FT                   RELVRDLVAELVGRLISWALEAVATLGLATPVIVAQATTAISRMCSRIADLVRKLVRTI
FT                   SNVAPRIRSVVDKLGEIMQKLGRLGRRADTPSGPDTPNLAGGRPATPDAPSGTTSPSGT
FT                   TSPSGTTSPSGTTSPSGTPAPSSTTTPSGTSSPDPAPTGTSPGGTTTTSGAAPSPARPD
FT                   SATPDSTSPSARDQAGADPKASARPTSGRPTCGDPVDVVSGQVLLPQTDVALGGALPLL
FT                   LTRTHLSGHRAGARFGTSWASTLDQRLEVDEEGVCFVTEDGMVLLYPHPGATPVLPVEG
FT                   PRWPLSSTGDGGYEVVDAEAGLTRRFTPSAGGPLPLGSITDLNGNRVTVDHDVDGVPTD
FT                   VRHSGGYHVSVRSTGGLVTSLVLAGPEDITLIRYGYDAERRLTEVVNSSGAALRFSYDD
FT                   DQRVVGWQDRNGMWYRYGYDDRGRCVLNEGADDYLSGTFAYLDGRTVYTDALGNRTEFH
FT                   LNRAHQVVREVDAGGGVVVSEWDRHDRLLSRTDQLGRTTTHRYDEDGNLVALVRPDGRE
FT                   STATYDAGRMPLVVEDVDGAVWRREYDPRGNLLAVTDPSGARTRFDRDERGNAVAITGP
FT                   LGEVRRIDYDLAGLPVAITDAEGGRTGYRRDRFGRVREVTDPLGSTTTLGWTVEGRLAS
FT                   RTLPDGSVERWRYDGEGNPVEHVDAAGAVSRTGYTGFDQPAWHVGPDGARLEFGYDPNL
FT                   RLTSVVNARGQAWTYRYGPTGALVVETDFDGRSTTYVHDATGQLTAKVNGAGERIAYEH
FT                   DELGRLRAKRTPHGDTTYDHDPAGRLIRAVSRDADVLVERDLLGRIVAETVNGRTLRSE
FT                   HDASGNRVRRVTPTGAVSEWEHDGTGRATALLAGGRRTAFGYDAAGREVQRLVGDSTRL
FT                   GQVWDANHRLLAQDLTARGARVQRRDYRYRADGNLLAVDDLLAGPRRYELDPAGRVTSV
FT                   LGSGWSEGYAYDRAGELTWATGPGETSGARSYAGTLIRRAGDVHFEHDAQGRVVVRAHR
FT                   TLSGRERTWRYGWDAEDRMVSATTPDGARWAYRYDGLGRRVAKERLDAGGAVVERVDFV
FT                   WDGLVLVEQITAGTALTWDYEPGSHRPLTQVERVLAAPQEWVDARFHAVVSDVVGMPSE
FT                   LLDDAGALVWRSQRTLWGAVLAELAGGPDCPLRFAGQYHDRETGLFYNVHRYYDPETAR
FT                   YSSPDPLGLLAGPNPHAYVVNPLRLTDPLGLSGCERARKIADRVVERAQQGRVREASNY
FT                   HGRLSRERELEILSNPDGVYHSTGSGGRLIFRQGDDILITEGPGSSAGQLVTSYGPSGP
FT                   RGESGASIFGGAPSDPGLPVTHDMIVEGRIPVPGGGTLPAAVQVLPRP"
     MDNPLVAAPR SDTTAVTGIG IAESSVDLAN GIADGNWVEA GLGGAGVGLE VLSMVIDPVG        60
     TVASYGVGWL MEHVQPLKEA LDWLAGDPPV IRSFSETWGN VAAEVRAVAE ELGGQDAPGW       120
     EGAAAQAFRG ANAETADAIA GAGVLAEGVG IGVMVMGEVV AAVRELVRDL VAELVGRLIS       180
     WALEAVATLG LATPVIVAQA TTAISRMCSR IADLVRKLVR TISNVAPRIR SVVDKLGEIM       240
     QKLGRLGRRA DTPSGPDTPN LAGGRPATPD APSGTTSPSG TTSPSGTTSP SGTTSPSGTP       300
     APSSTTTPSG TSSPDPAPTG TSPGGTTTTS GAAPSPARPD SATPDSTSPS ARDQAGADPK       360
     ASARPTSGRP TCGDPVDVVS GQVLLPQTDV ALGGALPLLL TRTHLSGHRA GARFGTSWAS       420
     TLDQRLEVDE EGVCFVTEDG MVLLYPHPGA TPVLPVEGPR WPLSSTGDGG YEVVDAEAGL       480
     TRRFTPSAGG PLPLGSITDL NGNRVTVDHD VDGVPTDVRH SGGYHVSVRS TGGLVTSLVL       540
     AGPEDITLIR YGYDAERRLT EVVNSSGAAL RFSYDDDQRV VGWQDRNGMW YRYGYDDRGR       600
     CVLNEGADDY LSGTFAYLDG RTVYTDALGN RTEFHLNRAH QVVREVDAGG GVVVSEWDRH       660
     DRLLSRTDQL GRTTTHRYDE DGNLVALVRP DGRESTATYD AGRMPLVVED VDGAVWRREY       720
     DPRGNLLAVT DPSGARTRFD RDERGNAVAI TGPLGEVRRI DYDLAGLPVA ITDAEGGRTG       780
     YRRDRFGRVR EVTDPLGSTT TLGWTVEGRL ASRTLPDGSV ERWRYDGEGN PVEHVDAAGA       840
     VSRTGYTGFD QPAWHVGPDG ARLEFGYDPN LRLTSVVNAR GQAWTYRYGP TGALVVETDF       900
     DGRSTTYVHD ATGQLTAKVN GAGERIAYEH DELGRLRAKR TPHGDTTYDH DPAGRLIRAV       960
     SRDADVLVER DLLGRIVAET VNGRTLRSEH DASGNRVRRV TPTGAVSEWE HDGTGRATAL      1020
     LAGGRRTAFG YDAAGREVQR LVGDSTRLGQ VWDANHRLLA QDLTARGARV QRRDYRYRAD      1080
     GNLLAVDDLL AGPRRYELDP AGRVTSVLGS GWSEGYAYDR AGELTWATGP GETSGARSYA      1140
     GTLIRRAGDV HFEHDAQGRV VVRAHRTLSG RERTWRYGWD AEDRMVSATT PDGARWAYRY      1200
     DGLGRRVAKE RLDAGGAVVE RVDFVWDGLV LVEQITAGTA LTWDYEPGSH RPLTQVERVL      1260
     AAPQEWVDAR FHAVVSDVVG MPSELLDDAG ALVWRSQRTL WGAVLAELAG GPDCPLRFAG      1320
     QYHDRETGLF YNVHRYYDPE TARYSSPDPL GLLAGPNPHA YVVNPLRLTD PLGLSGCERA      1380
     RKIADRVVER AQQGRVREAS NYHGRLSRER ELEILSNPDG VYHSTGSGGR LIFRQGDDIL      1440
     ITEGPGSSAG QLVTSYGPSG PRGESGASIF GGAPSDPGLP VTHDMIVEGR IPVPGGGTLP      1500
     AAVQVLPRP                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page