(data stored in ACNUC7421 zone)

EMBL: CP001630.PE565

CP001630.PE565       Location/Qualifiers
FT   CDS             631013..631729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34539"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34539.1"
FT                   /translation="MDFEVARGEPLPHVPRLVLDTRAVLVGPYGSAVEHERHVLDTAGA
FT                   GGWPDTEDDEYRFDRDTGTLVSALLHIPDAQTSALPWHIPPGEPAALRTQAAQPRPPAP
FT                   THWLSPDTSTLVCAYASHPAPLPPLHRVDTAPDFALLLLPDNTLSGWLLAHPDRHVTTA
FT                   WEQATPELPDEPFRAAFTTYFSLTTPEAVEALEDGAPNVLSQLSELRDTIPLSEGVHSR
FT                   RAALHHAVEGLLDFYG"
     MDFEVARGEP LPHVPRLVLD TRAVLVGPYG SAVEHERHVL DTAGAGGWPD TEDDEYRFDR        60
     DTGTLVSALL HIPDAQTSAL PWHIPPGEPA ALRTQAAQPR PPAPTHWLSP DTSTLVCAYA       120
     SHPAPLPPLH RVDTAPDFAL LLLPDNTLSG WLLAHPDRHV TTAWEQATPE LPDEPFRAAF       180
     TTYFSLTTPE AVEALEDGAP NVLSQLSELR DTIPLSEGVH SRRAALHHAV EGLLDFYG         238
//

If you have problems or comments...

PBIL Back to PBIL home page