(data stored in ACNUC7421 zone)

EMBL: CP001630.PE566

CP001630.PE566       Location/Qualifiers
FT   CDS             631738..632154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34540"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34540.1"
FT                   /translation="MTTREDLHALLTTPDLPHPERTRRVRALTDVEDHITQTPSMTPIL
FT                   CKALSLRSRAAPNEDILQVLAEIKAPTSLPCLREALHWQPEWDEFDQVGVKALWAINAV
FT                   NTAEARRLVAGAAERGPEAVRDWARRKLDQHPAE"
     MTTREDLHAL LTTPDLPHPE RTRRVRALTD VEDHITQTPS MTPILCKALS LRSRAAPNED        60
     ILQVLAEIKA PTSLPCLREA LHWQPEWDEF DQVGVKALWA INAVNTAEAR RLVAGAAERG       120
     PEAVRDWARR KLDQHPAE                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page