(data stored in ACNUC7421 zone)

EMBL: CP001630.PE567

CP001630.PE567       Location/Qualifiers
FT   CDS             complement(632186..632659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0575"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bbt:BBta_3942 putative
FT                   NUDIX-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34541"
FT                   /db_xref="GOA:C6WJA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34541.1"
FT                   /translation="MARTDHYDDPNAPEATRIVVAVTAFVQDQQGRLLMIRRTDNGLYS
FT                   IPGGAQDVGETIGRTVVREVKEETGVDVEPVDVIGVYSDPAHVVSYTDGEVRQEFSICF
FT                   RATLVGGELRTSGESSEVCWIGRDELAALDIHPSIRLRIEHGFGARDRPYFAT"
     MARTDHYDDP NAPEATRIVV AVTAFVQDQQ GRLLMIRRTD NGLYSIPGGA QDVGETIGRT        60
     VVREVKEETG VDVEPVDVIG VYSDPAHVVS YTDGEVRQEF SICFRATLVG GELRTSGESS       120
     EVCWIGRDEL AALDIHPSIR LRIEHGFGAR DRPYFAT                                157
//

If you have problems or comments...

PBIL Back to PBIL home page