(data stored in ACNUC7421 zone)

EMBL: CP001630.PE568

CP001630.PE568       Location/Qualifiers
FT   CDS             633802..636642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0576"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; TPR repeat-containing protein; NB-
FT                   ARC domain protein; transcriptional regulator domain
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34542"
FT                   /db_xref="GOA:C6WJB0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB0"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34542.1"
FT                   /translation="MEFGLLGPLAISHEGSPITLTKAVPRATLAVLLLHHGHPVAVERI
FT                   IDVVWSEADGPPLTARSMVQRSVNSLRELFKVDPETTLRTRPGGYELTCREGALDLRRF
FT                   EDLVDQADGCGSLREMAAVLREALRLWRGDPLSDVTNRGLESFKTGLTERRLTVVERCI
FT                   ELELQLGRHQEIVAELQSWTDTHPFRESLLALLMLALHRGGRTTDALAAYADFRARLAE
FT                   EVGTDPGTAVRMLHERILNNDHTLAAPVQRGVDTAIPQTATDHADTPSQPAWVVPRQLP
FT                   AGPRWLVGRDEQLAQLGQALAARETGQMAGAGTPVVVVVDGMAGIGKTALALTFAHQVS
FT                   DRFPDGQLYLNLRGFGPAGTPMAAGEAVRTCLDALAVAVDDIPTSLQAQAGLYRSLIAN
FT                   RRMLVVLDNAADAEQVRPLLPASPASMVIITSRRRLESLVATDGAIPLALEVLNAAQAY
FT                   ALLEAGVGAARLAAEPDEVDELIARCAGLPLALRIVLARALTRPGFALAALVSTLRAAQ
FT                   DRLGSFDGGDPVTNLRVVFSWSYRDLPADTAWVFRSLAVHPGPEMSESSIASTSGLSRP
FT                   ATRAALAELVQLHLLQERALGRFSLHDLIRLYAVDHLHGDGDEVIGRARQRLADHYLHS
FT                   AHRAAMLLYPSRDPITIAAPLPGVCLDEFAGELEARAWFGTEHAVLLAVLHDAARHGLH
FT                   AHAWQIPWSMVDYLDWGGHWRDYIATQQIALDASAALGDLNGQIRAHRGLGRAHLRLGD
FT                   IETARGFLTRSLQLSRQSNDPLGEAQTHLILAWMHEQDGDFRSALGHAEQALEGMRAGH
FT                   DGRGVANALNTVGWYHTLLGQHSTALRYCGQALEQHEQLDDPQGHADTWDSLGHAHRGL
FT                   QDLPQAITCYTRAVELYRTIQHGYDEATTQASLAETLLLSGDKDRARATWEHALTLLAP
FT                   LDPDEADAIRSRLTAL"
     MEFGLLGPLA ISHEGSPITL TKAVPRATLA VLLLHHGHPV AVERIIDVVW SEADGPPLTA        60
     RSMVQRSVNS LRELFKVDPE TTLRTRPGGY ELTCREGALD LRRFEDLVDQ ADGCGSLREM       120
     AAVLREALRL WRGDPLSDVT NRGLESFKTG LTERRLTVVE RCIELELQLG RHQEIVAELQ       180
     SWTDTHPFRE SLLALLMLAL HRGGRTTDAL AAYADFRARL AEEVGTDPGT AVRMLHERIL       240
     NNDHTLAAPV QRGVDTAIPQ TATDHADTPS QPAWVVPRQL PAGPRWLVGR DEQLAQLGQA       300
     LAARETGQMA GAGTPVVVVV DGMAGIGKTA LALTFAHQVS DRFPDGQLYL NLRGFGPAGT       360
     PMAAGEAVRT CLDALAVAVD DIPTSLQAQA GLYRSLIANR RMLVVLDNAA DAEQVRPLLP       420
     ASPASMVIIT SRRRLESLVA TDGAIPLALE VLNAAQAYAL LEAGVGAARL AAEPDEVDEL       480
     IARCAGLPLA LRIVLARALT RPGFALAALV STLRAAQDRL GSFDGGDPVT NLRVVFSWSY       540
     RDLPADTAWV FRSLAVHPGP EMSESSIAST SGLSRPATRA ALAELVQLHL LQERALGRFS       600
     LHDLIRLYAV DHLHGDGDEV IGRARQRLAD HYLHSAHRAA MLLYPSRDPI TIAAPLPGVC       660
     LDEFAGELEA RAWFGTEHAV LLAVLHDAAR HGLHAHAWQI PWSMVDYLDW GGHWRDYIAT       720
     QQIALDASAA LGDLNGQIRA HRGLGRAHLR LGDIETARGF LTRSLQLSRQ SNDPLGEAQT       780
     HLILAWMHEQ DGDFRSALGH AEQALEGMRA GHDGRGVANA LNTVGWYHTL LGQHSTALRY       840
     CGQALEQHEQ LDDPQGHADT WDSLGHAHRG LQDLPQAITC YTRAVELYRT IQHGYDEATT       900
     QASLAETLLL SGDKDRARAT WEHALTLLAP LDPDEADAIR SRLTAL                      946
//

If you have problems or comments...

PBIL Back to PBIL home page