(data stored in ACNUC7421 zone)

EMBL: CP001630.PE569

CP001630.PE569       Location/Qualifiers
FT   CDS             636814..637278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34543"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34543.1"
FT                   /translation="MNTLYRLITATATGIGLAVLAGASATATAATPADGPAAPTTTSAA
FT                   AQFEMALAPSQTRQLPAGLAVPDATVTAEGIGVLAQGGFDRDHWWIKISKAEVIAIGAN
FT                   AVCRAVFRTAGGVVCPPIVAAVNWLVAQFPNAGGFWAELYTNGRVRAGTW"
     MNTLYRLITA TATGIGLAVL AGASATATAA TPADGPAAPT TTSAAAQFEM ALAPSQTRQL        60
     PAGLAVPDAT VTAEGIGVLA QGGFDRDHWW IKISKAEVIA IGANAVCRAV FRTAGGVVCP       120
     PIVAAVNWLV AQFPNAGGFW AELYTNGRVR AGTW                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page