(data stored in ACNUC7421 zone)

EMBL: CP001630.PE57

CP001630.PE57        Location/Qualifiers
FT   CDS             complement(65703..68078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0057"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   xcb:XC_3634 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34031"
FT                   /db_xref="GOA:C6WDN6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACU34031.1"
FT                   /translation="MNTPVACTATAESGLPSALVLARSYLAHHPGHRFTIAVLDGEDGG
FT                   RRGSDGVTVIGPDLIGPSRDEFLGLATAHPLPQLVDAVKPWLMRGQLRNASRVTWFSPT
FT                   SFVTAPIGEQRGTVVAPHLLRPLTGEAAESAEARLIGTGVLNPGYLSTDDESLLDAWVE
FT                   AVAAFRAVRFDRDALSDQDWFDQALSLVPHEVSTDPGLVLTAWNAFERPGVEPKVVDLL
FT                   GFEPRAPWVLSSLLLDRPAALLSERPDLVPLVREYADLLIAAGHLDEEEVLPTWLDELP
FT                   DGTPLTPLLRGTYRAAVLASTDPRRAKRPAAPPHAFTGAEFRDWLNGPGELGGTTRFTR
FT                   AVWDSRPDLQAVFGRPVHPGFAHWCRESAPAEGVLPAWAVPVPDDPPSAPQDRLGVNLL
FT                   GHLTAVLGVGELGRVLNSALSRSGLDVAPVVEEAMVVNRTDVDRPEESAPVYPVSVLCV
FT                   NADLVRAVSEQHPQVVHERYRIGVWSWELEEFPEAMREFDCVDEVWTISEYCRAAIAPH
FT                   TDKPVRVFPIPIRERPAVEFRAGGPVRFLFAMDFNSLVERKNPFGAVEAFRRAFPDRED
FT                   VELVVKVINGERHVAGLERLRSAAAGDPRVTLLERYLTAEELHDLYAGSDCYVSLHRAE
FT                   GFGFTVAEAMAMGLPVITTDYSGTAEFVDRENCWLVPAEPVPVGPGSPPYPADALWADP
FT                   DLDVAAAAMREVADDPARAAERGLAAREHLRRTRGEDAAAEWVRDRVEQAHRTWRERRA
FT                   PAQAQAAPEAKPQLVVPLLRKVAVRALGRYDSARHRDR"
     MNTPVACTAT AESGLPSALV LARSYLAHHP GHRFTIAVLD GEDGGRRGSD GVTVIGPDLI        60
     GPSRDEFLGL ATAHPLPQLV DAVKPWLMRG QLRNASRVTW FSPTSFVTAP IGEQRGTVVA       120
     PHLLRPLTGE AAESAEARLI GTGVLNPGYL STDDESLLDA WVEAVAAFRA VRFDRDALSD       180
     QDWFDQALSL VPHEVSTDPG LVLTAWNAFE RPGVEPKVVD LLGFEPRAPW VLSSLLLDRP       240
     AALLSERPDL VPLVREYADL LIAAGHLDEE EVLPTWLDEL PDGTPLTPLL RGTYRAAVLA       300
     STDPRRAKRP AAPPHAFTGA EFRDWLNGPG ELGGTTRFTR AVWDSRPDLQ AVFGRPVHPG       360
     FAHWCRESAP AEGVLPAWAV PVPDDPPSAP QDRLGVNLLG HLTAVLGVGE LGRVLNSALS       420
     RSGLDVAPVV EEAMVVNRTD VDRPEESAPV YPVSVLCVNA DLVRAVSEQH PQVVHERYRI       480
     GVWSWELEEF PEAMREFDCV DEVWTISEYC RAAIAPHTDK PVRVFPIPIR ERPAVEFRAG       540
     GPVRFLFAMD FNSLVERKNP FGAVEAFRRA FPDREDVELV VKVINGERHV AGLERLRSAA       600
     AGDPRVTLLE RYLTAEELHD LYAGSDCYVS LHRAEGFGFT VAEAMAMGLP VITTDYSGTA       660
     EFVDRENCWL VPAEPVPVGP GSPPYPADAL WADPDLDVAA AAMREVADDP ARAAERGLAA       720
     REHLRRTRGE DAAAEWVRDR VEQAHRTWRE RRAPAQAQAA PEAKPQLVVP LLRKVAVRAL       780
     GRYDSARHRD R                                                            791
//

If you have problems or comments...

PBIL Back to PBIL home page