(data stored in ACNUC7421 zone)

EMBL: CP001630.PE570

CP001630.PE570       Location/Qualifiers
FT   CDS             637607..637975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34544"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34544.1"
FT                   /translation="MDGTNVFGDDVPELIDPRLLGADDEDRTLRAGATYVPGRYQDGRT
FT                   DIVDVEVVPTNDGHNVILAYSSLPRLVECMGEQQPWVELPATIDPASLQLGTGADMVLW
FT                   DQELPQELRREDGAHGQR"
     MDGTNVFGDD VPELIDPRLL GADDEDRTLR AGATYVPGRY QDGRTDIVDV EVVPTNDGHN        60
     VILAYSSLPR LVECMGEQQP WVELPATIDP ASLQLGTGAD MVLWDQELPQ ELRREDGAHG       120
     QR                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page