(data stored in ACNUC7421 zone)

EMBL: CP001630.PE571

CP001630.PE571       Location/Qualifiers
FT   CDS             637962..638327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34545"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34545.1"
FT                   /translation="MDSGKFRVDLDELRPIGRLLADAQQDLREQCERMPHQVTDAGRST
FT                   AALDAALVALLGGAAELLSSLGSAHDSLSGTYEEYRDTEDRNVIGQQRLAGLDALFTPT
FT                   RHPWAGNTAGHPSTEHP"
     MDSGKFRVDL DELRPIGRLL ADAQQDLREQ CERMPHQVTD AGRSTAALDA ALVALLGGAA        60
     ELLSSLGSAH DSLSGTYEEY RDTEDRNVIG QQRLAGLDAL FTPTRHPWAG NTAGHPSTEH       120
     P                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page