(data stored in ACNUC7421 zone)

EMBL: CP001630.PE572

CP001630.PE572       Location/Qualifiers
FT   CDS             638324..639445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34546"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34546.1"
FT                   /translation="MIAPISGPQMPLPQPPRPIMGGHTLATRVDGDIRQLWDKIAWLTG
FT                   VAFEIARVQDTLHAARAASLQAWDGRAADRARDKLGRDGATAGDLAAAARRVVQALTVF
FT                   VYELEAVVESMAQARDLARSAGYRLTADTIQFPLPIVDPAATGPGRTITALVTAARRKE
FT                   AAAHQAIQTDVAKEKTFFEAFLTPTRMLGVARGVFTTSMVTYLAKPAPAVGQFTAAELT
FT                   ARLNTAVAFADNTTGGLRHTALSQAFDLAPRIPAAELNAPLTLGPARLVGNDMPYAKAV
FT                   LKPLHVPGGVLGLAGTGLSIMHGTPPTTAAAAGAGGWAAGAAASGLTEVLLTAATAARF
FT                   GALAAGPIGWAAFVVGTAVSAGVGYAIEHHWSD"
     MIAPISGPQM PLPQPPRPIM GGHTLATRVD GDIRQLWDKI AWLTGVAFEI ARVQDTLHAA        60
     RAASLQAWDG RAADRARDKL GRDGATAGDL AAAARRVVQA LTVFVYELEA VVESMAQARD       120
     LARSAGYRLT ADTIQFPLPI VDPAATGPGR TITALVTAAR RKEAAAHQAI QTDVAKEKTF       180
     FEAFLTPTRM LGVARGVFTT SMVTYLAKPA PAVGQFTAAE LTARLNTAVA FADNTTGGLR       240
     HTALSQAFDL APRIPAAELN APLTLGPARL VGNDMPYAKA VLKPLHVPGG VLGLAGTGLS       300
     IMHGTPPTTA AAAGAGGWAA GAAASGLTEV LLTAATAARF GALAAGPIGW AAFVVGTAVS       360
     AGVGYAIEHH WSD                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page