(data stored in ACNUC7421 zone)

EMBL: CP001630.PE573

CP001630.PE573       Location/Qualifiers
FT   CDS             640633..641100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34547"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB5"
FT                   /inference="similar to AA sequence:KEGG:Pcar_0786"
FT                   /protein_id="ACU34547.1"
FT                   /translation="MTENRAAKREIRELQQITGLSYTEITRLKRVFDEVLEREPHLNLN
FT                   GFGLSWFGTQTLAERREQARAWRDELRRSAADVIEVCQWLRENIRPIKTPQQRSYGLKH
FT                   LVEQNIGKYVSNGELIAAALMAGYPMGPIDGPNTVFGMSQRDVNRLRAGAR"
     MTENRAAKRE IRELQQITGL SYTEITRLKR VFDEVLEREP HLNLNGFGLS WFGTQTLAER        60
     REQARAWRDE LRRSAADVIE VCQWLRENIR PIKTPQQRSY GLKHLVEQNI GKYVSNGELI       120
     AAALMAGYPM GPIDGPNTVF GMSQRDVNRL RAGAR                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page