(data stored in ACNUC7421 zone)

EMBL: CP001630.PE574

CP001630.PE574       Location/Qualifiers
FT   CDS             641901..642743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0583"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34548"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6W8S8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34548.1"
FT                   /translation="MAKPLVAELSTKKVLHRQGLHVLFYRAALPLSHQTLTFVSGLVRA
FT                   HRKQLGSVWRKLNPGQQALLVLVYLRKGETFADLAAGFAVSTSTCWRYVNETVELLAQR
FT                   SPKLREALRKAKRQGMAHVVIDGTLIPIDRIAADRPFYSGKHKIHGVNLQVIASPDGTI
FT                   LWVSGDLPGSTHDTAAARIWNILAALRHAGLIALGDKGYHAYDPTDRHVITPYKGRNKP
FT                   ESQKDANRAHARLRGPGERANAQLKTWRILRKLRCCPRRAGRLAKAIHVLQNYEATTG"
     MAKPLVAELS TKKVLHRQGL HVLFYRAALP LSHQTLTFVS GLVRAHRKQL GSVWRKLNPG        60
     QQALLVLVYL RKGETFADLA AGFAVSTSTC WRYVNETVEL LAQRSPKLRE ALRKAKRQGM       120
     AHVVIDGTLI PIDRIAADRP FYSGKHKIHG VNLQVIASPD GTILWVSGDL PGSTHDTAAA       180
     RIWNILAALR HAGLIALGDK GYHAYDPTDR HVITPYKGRN KPESQKDANR AHARLRGPGE       240
     RANAQLKTWR ILRKLRCCPR RAGRLAKAIH VLQNYEATTG                             280
//

If you have problems or comments...

PBIL Back to PBIL home page