(data stored in ACNUC7421 zone)

EMBL: CP001630.PE575

CP001630.PE575       Location/Qualifiers
FT   CDS             complement(642722..642826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34549"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34549.1"
FT                   /translation="MCARLITDYAMYSVTMSSEPLLDALSLFHPVVAS"
     MCARLITDYA MYSVTMSSEP LLDALSLFHP VVAS                                    34
//

If you have problems or comments...

PBIL Back to PBIL home page