(data stored in ACNUC7421 zone)

EMBL: CP001630.PE576

CP001630.PE576       Location/Qualifiers
FT   CDS             complement(642843..643604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0585"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34550"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34550.1"
FT                   /translation="MLVYPSAIDLSSSHLQFLARELTTHRRRIGSRWRRLDPGRQALLV
FT                   LAHLRCGDTYTRLAVGFGVGLATVCRYIHEAVELLAALAPDLADAAKVASRKAYVILDG
FT                   TLLLIDRVAADRPYYSGKHKRHGMNVQVLADPAGRLLRVSPALPGSVHDLTAARIHGIV
FT                   DALAAADIPCWADKAYRGAGGPVRVPYRGKWHNLSPGQQAVNRSHARIRAPGERAVSTL
FT                   KTWRLLRRLRCSTTHITNLTRAVLTLHLNAG"
     MLVYPSAIDL SSSHLQFLAR ELTTHRRRIG SRWRRLDPGR QALLVLAHLR CGDTYTRLAV        60
     GFGVGLATVC RYIHEAVELL AALAPDLADA AKVASRKAYV ILDGTLLLID RVAADRPYYS       120
     GKHKRHGMNV QVLADPAGRL LRVSPALPGS VHDLTAARIH GIVDALAAAD IPCWADKAYR       180
     GAGGPVRVPY RGKWHNLSPG QQAVNRSHAR IRAPGERAVS TLKTWRLLRR LRCSTTHITN       240
     LTRAVLTLHL NAG                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page