(data stored in ACNUC7421 zone)

EMBL: CP001630.PE577

CP001630.PE577       Location/Qualifiers
FT   CDS             complement(643644..644723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34551"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34551.1"
FT                   /translation="MPLLNEMPLERANQIFRHPIHQEGVSTLERLITALRQCRSAEDFY
FT                   DFQQDLLARVLEVQEHRAACRRVAKLLRQGKAVPADAPELRSADPATSPETWDLEADVC
FT                   ERVDRQLRSVADGLAWRVFSYDRRVIIALSRNQHPGPMAGKKGLAAERAFVIDWWRDEG
FT                   RFVLLHDLTSCLTIGDATSFKEIGNEYEAYLHEIKSDPNRIVSRQARRQRMAEEAIRSG
FT                   GQLPGDLPGRLVPLDIPYKTHLNLLGTAFDLARDRGVQGMKVPGGRALVASDIVRGYDL
FT                   WSEREFIDRTAAEHLQAVKRARILDVGHLVWARSDDLVARSPTMPPWSIYPLSPSLSPF
FT                   QPGVVGLRSCWRRGEAPGR"
     MPLLNEMPLE RANQIFRHPI HQEGVSTLER LITALRQCRS AEDFYDFQQD LLARVLEVQE        60
     HRAACRRVAK LLRQGKAVPA DAPELRSADP ATSPETWDLE ADVCERVDRQ LRSVADGLAW       120
     RVFSYDRRVI IALSRNQHPG PMAGKKGLAA ERAFVIDWWR DEGRFVLLHD LTSCLTIGDA       180
     TSFKEIGNEY EAYLHEIKSD PNRIVSRQAR RQRMAEEAIR SGGQLPGDLP GRLVPLDIPY       240
     KTHLNLLGTA FDLARDRGVQ GMKVPGGRAL VASDIVRGYD LWSEREFIDR TAAEHLQAVK       300
     RARILDVGHL VWARSDDLVA RSPTMPPWSI YPLSPSLSPF QPGVVGLRSC WRRGEAPGR        359
//

If you have problems or comments...

PBIL Back to PBIL home page