(data stored in ACNUC7421 zone)

EMBL: CP001630.PE578

CP001630.PE578       Location/Qualifiers
FT   CDS             645528..646220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2228 putative carboxynorspermidine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34552"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34552.1"
FT                   /translation="MQIVDGLTYNGATRLKKRSMLPNAAGIYIWTLQLGHHLTRAEMSA
FT                   DLMVEAISAPFKQVRENRFDSGKLGHYRRVQLYDEPASLSPSSMARLAALLDGGSAELS
FT                   WSLMCATLFQRPLYVGKALNFRDRLPCHFGYKSKFSRLLREHGMSVNDCAVVLCPVTID
FT                   GLAADEDDDRDDLTDSVEGVPPLMEDGDDLEPEEYVPPGKAELNNVIQFAESLVIRTSH
FT                   PLFNERMD"
     MQIVDGLTYN GATRLKKRSM LPNAAGIYIW TLQLGHHLTR AEMSADLMVE AISAPFKQVR        60
     ENRFDSGKLG HYRRVQLYDE PASLSPSSMA RLAALLDGGS AELSWSLMCA TLFQRPLYVG       120
     KALNFRDRLP CHFGYKSKFS RLLREHGMSV NDCAVVLCPV TIDGLAADED DDRDDLTDSV       180
     EGVPPLMEDG DDLEPEEYVP PGKAELNNVI QFAESLVIRT SHPLFNERMD                  230
//

If you have problems or comments...

PBIL Back to PBIL home page