(data stored in ACNUC7421 zone)

EMBL: CP001630.PE579

CP001630.PE579       Location/Qualifiers
FT   CDS             646222..648237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34553"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34553.1"
FT                   /translation="MTALSKFGGAAAPAWTSDFQFVRGEYAIGGEQVPYFCTTMKVEEA
FT                   RKYLNLARELAVDPADPINIEELMQRDIDSDRANSEIAEYLKQPARIKFFNSLTIVLVP
FT                   VEKDGRSKKAFDENVPLPQDLVTEDFDVIQAGPVVARLLTGTNVGYLRWQPEHVRAIII
FT                   DGQHRFMALNAVHDEQPTTLKPHVTSIPVLILVLDSRAGFVPPAGGPSEITTASRSIFT
FT                   DLNKHAVKVTPEREYLLDDRSVTAVCMRALITPGLRSEELPSTASWPAQIPLAAVDWVR
FT                   TNRSKFDDGFSITTLQVLHQLVDDVVDSRKPSASTDYEAMKAWTDQLTARLELEAVPGW
FT                   SVDALDTRLKTDELEEAPFALLNSEVKAAALGFRDSVGKVITAVLLAGLPYAELLSRYR
FT                   EVGLLGGTQELWLGQGTEGRNAYKAAYAEDPSPAASQIAAEVKGRYRLAYQVVFQRGFV
FT                   LAAREIDSNRAVLAPLWNVDSGSREDLLAAWILRFNNLARQTLTREGLWTGAAVNSDGT
FT                   IDYTQVSKTAIMGLVVLATTMGLPVGESGGAEQSNDDIRAMLRPSSSGDAVLLAADPFA
FT                   LAEANEIHVAGARRWLQALALGSRRQDGTAPLLRAAASAYRKGVRRYVLGLSKVDGRVL
FT                   TKESLEKMIKIHGARRLAHFAELLAPAADSVPIAES"
     MTALSKFGGA AAPAWTSDFQ FVRGEYAIGG EQVPYFCTTM KVEEARKYLN LARELAVDPA        60
     DPINIEELMQ RDIDSDRANS EIAEYLKQPA RIKFFNSLTI VLVPVEKDGR SKKAFDENVP       120
     LPQDLVTEDF DVIQAGPVVA RLLTGTNVGY LRWQPEHVRA IIIDGQHRFM ALNAVHDEQP       180
     TTLKPHVTSI PVLILVLDSR AGFVPPAGGP SEITTASRSI FTDLNKHAVK VTPEREYLLD       240
     DRSVTAVCMR ALITPGLRSE ELPSTASWPA QIPLAAVDWV RTNRSKFDDG FSITTLQVLH       300
     QLVDDVVDSR KPSASTDYEA MKAWTDQLTA RLELEAVPGW SVDALDTRLK TDELEEAPFA       360
     LLNSEVKAAA LGFRDSVGKV ITAVLLAGLP YAELLSRYRE VGLLGGTQEL WLGQGTEGRN       420
     AYKAAYAEDP SPAASQIAAE VKGRYRLAYQ VVFQRGFVLA AREIDSNRAV LAPLWNVDSG       480
     SREDLLAAWI LRFNNLARQT LTREGLWTGA AVNSDGTIDY TQVSKTAIMG LVVLATTMGL       540
     PVGESGGAEQ SNDDIRAMLR PSSSGDAVLL AADPFALAEA NEIHVAGARR WLQALALGSR       600
     RQDGTAPLLR AAASAYRKGV RRYVLGLSKV DGRVLTKESL EKMIKIHGAR RLAHFAELLA       660
     PAADSVPIAE S                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page