(data stored in ACNUC7421 zone)

EMBL: CP001630.PE58

CP001630.PE58        Location/Qualifiers
FT   CDS             complement(68337..69401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0058"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: swi:Swit_4011 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34032"
FT                   /db_xref="GOA:C6WDN7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34032.1"
FT                   /translation="MALDVLRDTWEKLGGVDPLWAVLTDPGRRDGRWDVEEFMRTGPEA
FT                   VGQVRTLLGERTLGSRVLDFGCGVGRLSNALAAHADRVVGVDIASTMVARARELNRHPD
FT                   RVEFVHYDGRLLPFEDASFDGALSLIVLQHARPWVQIGALLELLRVVRPGGTLVVQIPS
FT                   ARRAPAPMPEEAYRADIEVLEAPSALGVGQSALVRARVTNLSEHPWPGTKTIKLGNHWR
FT                   SGGEVVQLDDGRVGLPAMVAPGESFEVGVPVTAPRAGELVLELDLVHEMVTWWESEGGT
FT                   PARVPITVTASPAPPSEVTPAGEAHPGEQIEMHALHTEFVQALFGHCGAEVVAAVPDEA
FT                   AGEEWESFTYVVSR"
     MALDVLRDTW EKLGGVDPLW AVLTDPGRRD GRWDVEEFMR TGPEAVGQVR TLLGERTLGS        60
     RVLDFGCGVG RLSNALAAHA DRVVGVDIAS TMVARARELN RHPDRVEFVH YDGRLLPFED       120
     ASFDGALSLI VLQHARPWVQ IGALLELLRV VRPGGTLVVQ IPSARRAPAP MPEEAYRADI       180
     EVLEAPSALG VGQSALVRAR VTNLSEHPWP GTKTIKLGNH WRSGGEVVQL DDGRVGLPAM       240
     VAPGESFEVG VPVTAPRAGE LVLELDLVHE MVTWWESEGG TPARVPITVT ASPAPPSEVT       300
     PAGEAHPGEQ IEMHALHTEF VQALFGHCGA EVVAAVPDEA AGEEWESFTY VVSR             354
//

If you have problems or comments...

PBIL Back to PBIL home page