(data stored in ACNUC7421 zone)

EMBL: CP001630.PE580

CP001630.PE580       Location/Qualifiers
FT   CDS             complement(648541..649371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0590"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: swi:Swit_5329 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34554"
FT                   /db_xref="GOA:C6WJC2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC2"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ACU34554.1"
FT                   /translation="MTGANSSKVRHVLGISGGKDSSALAIYMRDRVPDMEYFFCDTGAE
FT                   LPETYEYLNRLEAALGKSIVRLNAARDFDHWMEVYQGTLPSPQMRWCTKNLKIKPLEEW
FT                   VGDDKVISYVAIRADENRLGYVSTKPNIDAVFPFREDGIDKDGVMRILDEAGIGLPGYY
FT                   EWRTRSGCYFCFFQRKHEWVGLKERHPELFDKAVAYEEKVRYRHTAMQGRNYTWSQGES
FT                   LHELIDRKDEIEAKHTAALERASKRIKPNRPLLEVLSDALDTDDDEAGCSVCHL"
     MTGANSSKVR HVLGISGGKD SSALAIYMRD RVPDMEYFFC DTGAELPETY EYLNRLEAAL        60
     GKSIVRLNAA RDFDHWMEVY QGTLPSPQMR WCTKNLKIKP LEEWVGDDKV ISYVAIRADE       120
     NRLGYVSTKP NIDAVFPFRE DGIDKDGVMR ILDEAGIGLP GYYEWRTRSG CYFCFFQRKH       180
     EWVGLKERHP ELFDKAVAYE EKVRYRHTAM QGRNYTWSQG ESLHELIDRK DEIEAKHTAA       240
     LERASKRIKP NRPLLEVLSD ALDTDDDEAG CSVCHL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page