(data stored in ACNUC7421 zone)

EMBL: CP001630.PE581

CP001630.PE581       Location/Qualifiers
FT   CDS             complement(649368..652946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_5328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34555.1"
FT                   /translation="MTVAAPSPPSRDTRTAIPEFPAGIALVGSQMRSTNLERDVRDALQ
FT                   SPYIGARAVDVLERITSAIADLRRTRAWSFTGPYGSGKSTLSNLIDALLGHDDSRRDEA
FT                   ERILTGTSPALAQRLAAARAERTNTGFLGAVATARREPLVSTLARALETAASRRWGKRA
FT                   PKAIASALANCSHPATTGAKQIMAAITAMTAEQPLLLIIDEFGKTLEHLAGHSEFASPE
FT                   HDLFLLQELAEHCAGPNGLPVYLLTLQHLSFLDYASRTSDLETREWAKIQGRFEDITFL
FT                   PHHGDSLQLLRRRLDHSAVSPAGKALIQVCADAAAREWKEHGLNILAELDSKDFADLYP
FT                   LHPLTAIAAPILAAQIGQHDRSLSGFLNSGEPNTVRDALTAHSRTDAERASTVRLPQLY
FT                   DYFLNAGRTSLLASPNASRWIEIDARIRDANGLPDSDQDLLKTIGVLNLIDADGALSAT
FT                   NEMIHFALRDPDDLVDAAAYAALEEQIADLVRRGFLVYREFSGEYRLWQGTDVDIDGRL
FT                   KEITSHLDEASVIQRLSAYVPSSVVAGRHSQVTGMLRVFVTAVSGPETSHVDAPDEMTE
FT                   PADGLVVFHLGTSTKRPVVDSTLPVVFGTTLNPDIVLSAATHLVALKELQQQALDHVAL
FT                   REVTDRAVQAEATFREIFQAAFYPPATDATWSTWHAGLPADQDPNTAQLMARSLSGLVS
FT                   QVCDEVYSQTPHIRNEMLGRHALTSQAARARSDLLDAMLTSSGKQDLGFPTDKYGPERA
FT                   MYRGVLAYLGLHRQNGAVQAEQTSDSLFPYGFSAPGDKDPERYAKPVWEALQQALTEAT
FT                   ERTSLDHVVRVVMSPPFGVKAGVWPLLVVTALLIRRHDVALFEEGTYLPRLTQDIVERL
FT                   EKVPSRFQVKYTPVSSGQRASVVKKLLVSLKVEPARSQALRNPDMLSVTRALLERVMVL
FT                   NKYARQTKQISSDALAVRKALVGSQDPDDLLFKALPKALGRGPIGPAARADAAAVDEYV
FT                   TRLTAAVDEIAAIDSKLRAKVVETLAHEFRLPSELHELRSTLAARLRGFADVALSAELK
FT                   GFVDFVLSDSLSDEDWLDPIVVRLTNSALGDWDDREAAMFPRRAREMAAALDRVGHLHR
FT                   TTDASAQEENLEAQLLTLTDKAGVEQRTLIYMPARSRAKAENLAADALKRAEKALGPDG
FT                   ARILLAALAQRVAEATTVAPETKEQA"
     MTVAAPSPPS RDTRTAIPEF PAGIALVGSQ MRSTNLERDV RDALQSPYIG ARAVDVLERI        60
     TSAIADLRRT RAWSFTGPYG SGKSTLSNLI DALLGHDDSR RDEAERILTG TSPALAQRLA       120
     AARAERTNTG FLGAVATARR EPLVSTLARA LETAASRRWG KRAPKAIASA LANCSHPATT       180
     GAKQIMAAIT AMTAEQPLLL IIDEFGKTLE HLAGHSEFAS PEHDLFLLQE LAEHCAGPNG       240
     LPVYLLTLQH LSFLDYASRT SDLETREWAK IQGRFEDITF LPHHGDSLQL LRRRLDHSAV       300
     SPAGKALIQV CADAAAREWK EHGLNILAEL DSKDFADLYP LHPLTAIAAP ILAAQIGQHD       360
     RSLSGFLNSG EPNTVRDALT AHSRTDAERA STVRLPQLYD YFLNAGRTSL LASPNASRWI       420
     EIDARIRDAN GLPDSDQDLL KTIGVLNLID ADGALSATNE MIHFALRDPD DLVDAAAYAA       480
     LEEQIADLVR RGFLVYREFS GEYRLWQGTD VDIDGRLKEI TSHLDEASVI QRLSAYVPSS       540
     VVAGRHSQVT GMLRVFVTAV SGPETSHVDA PDEMTEPADG LVVFHLGTST KRPVVDSTLP       600
     VVFGTTLNPD IVLSAATHLV ALKELQQQAL DHVALREVTD RAVQAEATFR EIFQAAFYPP       660
     ATDATWSTWH AGLPADQDPN TAQLMARSLS GLVSQVCDEV YSQTPHIRNE MLGRHALTSQ       720
     AARARSDLLD AMLTSSGKQD LGFPTDKYGP ERAMYRGVLA YLGLHRQNGA VQAEQTSDSL       780
     FPYGFSAPGD KDPERYAKPV WEALQQALTE ATERTSLDHV VRVVMSPPFG VKAGVWPLLV       840
     VTALLIRRHD VALFEEGTYL PRLTQDIVER LEKVPSRFQV KYTPVSSGQR ASVVKKLLVS       900
     LKVEPARSQA LRNPDMLSVT RALLERVMVL NKYARQTKQI SSDALAVRKA LVGSQDPDDL       960
     LFKALPKALG RGPIGPAARA DAAAVDEYVT RLTAAVDEIA AIDSKLRAKV VETLAHEFRL      1020
     PSELHELRST LAARLRGFAD VALSAELKGF VDFVLSDSLS DEDWLDPIVV RLTNSALGDW      1080
     DDREAAMFPR RAREMAAALD RVGHLHRTTD ASAQEENLEA QLLTLTDKAG VEQRTLIYMP      1140
     ARSRAKAENL AADALKRAEK ALGPDGARIL LAALAQRVAE ATTVAPETKE QA              1192
//

If you have problems or comments...

PBIL Back to PBIL home page