(data stored in ACNUC7421 zone)

EMBL: CP001630.PE582

CP001630.PE582       Location/Qualifiers
FT   CDS             complement(652943..654061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_5327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34556"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34556.1"
FT                   /translation="MADTRLAAAAHSSFARHETFAPRFGWLHKAYMRVKDNPGTFIAED
FT                   APVELGVGKNMVNAMRYWSKTFKLTREHLSEDGKTKAHIASPTWEARWLLDEDGADPYL
FT                   EDPGSLWLLHWWLVSSRPGAKCWAPTWYTAFHLAPFSRFSVVEMTQVVMRHVNFSFPEG
FT                   PVEASVTKDVDCLTKMYARTPAEQPAARTTDTKTGAKSNFEDLLACPFRELDLLTPVGS
FT                   RGNQQWQFTTGTRNSLPASVLVYACLDYAARDTSSSGSISLARLANEPGGPGRAFRVRE
FT                   PEIVAALDKVAAERADVSRVDAVGQRSMSFSGDPFVLAWDVLDEQYGYVTHRPGFPTRR
FT                   EWDQKYPMLAKVAMAESQQQKHQPLALMEEIA"
     MADTRLAAAA HSSFARHETF APRFGWLHKA YMRVKDNPGT FIAEDAPVEL GVGKNMVNAM        60
     RYWSKTFKLT REHLSEDGKT KAHIASPTWE ARWLLDEDGA DPYLEDPGSL WLLHWWLVSS       120
     RPGAKCWAPT WYTAFHLAPF SRFSVVEMTQ VVMRHVNFSF PEGPVEASVT KDVDCLTKMY       180
     ARTPAEQPAA RTTDTKTGAK SNFEDLLACP FRELDLLTPV GSRGNQQWQF TTGTRNSLPA       240
     SVLVYACLDY AARDTSSSGS ISLARLANEP GGPGRAFRVR EPEIVAALDK VAAERADVSR       300
     VDAVGQRSMS FSGDPFVLAW DVLDEQYGYV THRPGFPTRR EWDQKYPMLA KVAMAESQQQ       360
     KHQPLALMEE IA                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page