(data stored in ACNUC7421 zone)

EMBL: CP001630.PE583

CP001630.PE583       Location/Qualifiers
FT   CDS             complement(654119..655288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0593"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   afw:Anae109_1098 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34557"
FT                   /db_xref="GOA:C6WJC5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC5"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACU34557.1"
FT                   /translation="MEQSPVIYLDYNATAPTRPEALAAVVDAMHYVGNASSIHLPGQSA
FT                   AQRVDSARRQVAELLNCSPGEIIFTSGATEANNLALRAAHSSGRRLVTSNVEHPAVLET
FT                   ARDLTADQPGSLILLEVDADGLVDLAALENALGHGDIGLVSLMAANNETGVLTDLAPVV
FT                   TAAHAVGALVHTDATQMVGRLPIDLADLDVDLLSLSAHKFGGPQGIGALFVRRTASIPF
FT                   RPQVTGGGQERGWRAGTLNVPGIAGVGAAAAAVHRSLAEETARIGRLRDLLEHAVSASI
FT                   DGYRVNGHRVARLPGVSSITFPGAPADAVMAAMPHVAVSDGSACASGAPSPSHVLLAMG
FT                   INRHDADCTLRFSLGYATTEDHIMQAADATAHAVKLVRASMDACTPIPG"
     MEQSPVIYLD YNATAPTRPE ALAAVVDAMH YVGNASSIHL PGQSAAQRVD SARRQVAELL        60
     NCSPGEIIFT SGATEANNLA LRAAHSSGRR LVTSNVEHPA VLETARDLTA DQPGSLILLE       120
     VDADGLVDLA ALENALGHGD IGLVSLMAAN NETGVLTDLA PVVTAAHAVG ALVHTDATQM       180
     VGRLPIDLAD LDVDLLSLSA HKFGGPQGIG ALFVRRTASI PFRPQVTGGG QERGWRAGTL       240
     NVPGIAGVGA AAAAVHRSLA EETARIGRLR DLLEHAVSAS IDGYRVNGHR VARLPGVSSI       300
     TFPGAPADAV MAAMPHVAVS DGSACASGAP SPSHVLLAMG INRHDADCTL RFSLGYATTE       360
     DHIMQAADAT AHAVKLVRAS MDACTPIPG                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page