(data stored in ACNUC7421 zone)

EMBL: CP001630.PE584

CP001630.PE584       Location/Qualifiers
FT   CDS             655826..657403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0594"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; KEGG: nha:Nham_3708 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34558"
FT                   /db_xref="GOA:C6WJC6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC6"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACU34558.1"
FT                   /translation="MSYVRRQLGKDLCALLDLVEGGTASDERLRAVALVAIDAEQLVSD
FT                   ESGRKELLALLPADKQLELAKRLDADTSGPKNVLNAVNDLTWTIEQRRELLEFLGFTID
FT                   RAPTRTPLFRQDAEPLYGLFPHQRRAAARIKELIYDGPRRAVLHLPTGVGKTRTGMNLI
FT                   CDHLRDREPTLVVWLAHGQELLEQAAAEFEHAWSQLGNRPVSVVRMWGNAPTTLDDVAD
FT                   GVVILGLEKAVSAAKGSPEFLHTLASRSSLTVFDEAHQIIAPTFQRVVDALTIRPDASL
FT                   LGLTATPGRTWADIAQDERLSDFFLRQKVMLEIEGYSNPVTALIDQGYLAKPTMRTVAS
FT                   DAGLHLSARDRQMLARSFDIPAGIVDALAHDEQWNLKVVQTIMDLLAREHRRILVFAAS
FT                   VDHCRLIAAVLSAVSLDAEFITGESSPRHRKQVITRFKGTGRRPMILCNFGVLTTGFDA
FT                   PAASAAVIARPTKSLVLYSQMVGRVIRGPKAGGTSTCEIVTVVDPELPGFGDVAEAFTN
FT                   WEDVWEPA"
     MSYVRRQLGK DLCALLDLVE GGTASDERLR AVALVAIDAE QLVSDESGRK ELLALLPADK        60
     QLELAKRLDA DTSGPKNVLN AVNDLTWTIE QRRELLEFLG FTIDRAPTRT PLFRQDAEPL       120
     YGLFPHQRRA AARIKELIYD GPRRAVLHLP TGVGKTRTGM NLICDHLRDR EPTLVVWLAH       180
     GQELLEQAAA EFEHAWSQLG NRPVSVVRMW GNAPTTLDDV ADGVVILGLE KAVSAAKGSP       240
     EFLHTLASRS SLTVFDEAHQ IIAPTFQRVV DALTIRPDAS LLGLTATPGR TWADIAQDER       300
     LSDFFLRQKV MLEIEGYSNP VTALIDQGYL AKPTMRTVAS DAGLHLSARD RQMLARSFDI       360
     PAGIVDALAH DEQWNLKVVQ TIMDLLAREH RRILVFAASV DHCRLIAAVL SAVSLDAEFI       420
     TGESSPRHRK QVITRFKGTG RRPMILCNFG VLTTGFDAPA ASAAVIARPT KSLVLYSQMV       480
     GRVIRGPKAG GTSTCEIVTV VDPELPGFGD VAEAFTNWED VWEPA                       525
//

If you have problems or comments...

PBIL Back to PBIL home page