(data stored in ACNUC7421 zone)

EMBL: CP001630.PE585

CP001630.PE585       Location/Qualifiers
FT   CDS             657388..659277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0595"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34559.1"
FT                   /translation="MGARVTSDDSNYRIVTPALTVKAMRDSGYKNTAYALAELIDNSID
FT                   AGATLVEVFACESPVQVSSRTRQRVETIAVLDNGKGMDSETLRRALKYGDGLGDDRKRI
FT                   GRFGMGLPNSSMSQCTRVEVWSWTNGPGNALYTYLDLAEINDGRDAVPDPIHVQGGVPE
FT                   YWRDLSDGLLSDTGTLVVWRNLDRVNWYGAAATLKNTSELIGRVYRHFLHEDKVDIRMA
FT                   PVRDGEVVAGAYYAAPNDPLYLMKSTCAPTPFDDKPMFEPFNMGNENEPGVTYFPITVE
FT                   GIEHKVKVRAAIARPEARRPDVADHPWPAGASPNKDAGNHPWGKHAGRNIGISLVRQGR
FT                   ELDLDSSWAIGYDPVERWWGVEVEFPPALDEIFGVTNNKQTATIFSSLAHFDWQAEAEA
FT                   DETFKAFKDRLAELGDPRLQLFDLALYLETKLLRTMRRQLKQQTVGRRKSKKRHDDEVT
FT                   SKATDAVKRRRDEGHTGKTDQLEDGVTNQDKRQEQVDALTQRHHLDEDTAQSMVDEALE
FT                   KDWRVRWISSYQDTHAFFSIDLMAGMLQVIFNNSHPLHDQLLAVLEEVPEDATDSDLKY
FT                   RLRRAADTFKLLLFSWARMEDEIPNDRQREKIADARRDWGRYARDFIDGEADE"
     MGARVTSDDS NYRIVTPALT VKAMRDSGYK NTAYALAELI DNSIDAGATL VEVFACESPV        60
     QVSSRTRQRV ETIAVLDNGK GMDSETLRRA LKYGDGLGDD RKRIGRFGMG LPNSSMSQCT       120
     RVEVWSWTNG PGNALYTYLD LAEINDGRDA VPDPIHVQGG VPEYWRDLSD GLLSDTGTLV       180
     VWRNLDRVNW YGAAATLKNT SELIGRVYRH FLHEDKVDIR MAPVRDGEVV AGAYYAAPND       240
     PLYLMKSTCA PTPFDDKPMF EPFNMGNENE PGVTYFPITV EGIEHKVKVR AAIARPEARR       300
     PDVADHPWPA GASPNKDAGN HPWGKHAGRN IGISLVRQGR ELDLDSSWAI GYDPVERWWG       360
     VEVEFPPALD EIFGVTNNKQ TATIFSSLAH FDWQAEAEAD ETFKAFKDRL AELGDPRLQL       420
     FDLALYLETK LLRTMRRQLK QQTVGRRKSK KRHDDEVTSK ATDAVKRRRD EGHTGKTDQL       480
     EDGVTNQDKR QEQVDALTQR HHLDEDTAQS MVDEALEKDW RVRWISSYQD THAFFSIDLM       540
     AGMLQVIFNN SHPLHDQLLA VLEEVPEDAT DSDLKYRLRR AADTFKLLLF SWARMEDEIP       600
     NDRQREKIAD ARRDWGRYAR DFIDGEADE                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page