(data stored in ACNUC7421 zone)

EMBL: CP001630.PE586

CP001630.PE586       Location/Qualifiers
FT   CDS             659274..660161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB2173 bifunctional riboflavin kinase/FMN
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34560"
FT                   /db_xref="GOA:C6WJC8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34560.1"
FT                   /translation="MTEPDHVWRQIEVLLRSAGATALLVAPFIKKRVFEAALAVIPPSV
FT                   QRIDCVTRWTPSEVAAGVSDPEILDAANKDGRVHVALCPSLHAKIYSVDDRCLIGSANL
FT                   TAKATGLAPEANIELLIEAPASHPEVQRVVSELKAAAIPATTHMAALVRQQAELLTADG
FT                   ASEPRPAVSWYPVTRRPETLFTFYSGRSRFAEAVEAGLVQDLALLNIPAGLSEPQFNTA
FT                   VHDRLHAIPELRKLLNGQPLSNTELRHAIEERADVTEGQAHRITEIIAAWLKHFGSYYT
FT                   EVGSWELRHGRELG"
     MTEPDHVWRQ IEVLLRSAGA TALLVAPFIK KRVFEAALAV IPPSVQRIDC VTRWTPSEVA        60
     AGVSDPEILD AANKDGRVHV ALCPSLHAKI YSVDDRCLIG SANLTAKATG LAPEANIELL       120
     IEAPASHPEV QRVVSELKAA AIPATTHMAA LVRQQAELLT ADGASEPRPA VSWYPVTRRP       180
     ETLFTFYSGR SRFAEAVEAG LVQDLALLNI PAGLSEPQFN TAVHDRLHAI PELRKLLNGQ       240
     PLSNTELRHA IEERADVTEG QAHRITEIIA AWLKHFGSYY TEVGSWELRH GRELG            295
//

If you have problems or comments...

PBIL Back to PBIL home page