(data stored in ACNUC7421 zone)

EMBL: CP001630.PE59

CP001630.PE59        Location/Qualifiers
FT   CDS             complement(69961..70266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34033"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34033.1"
FT                   /translation="MNLHPRVGLPTRGWGDRSGYRHPFGKIAHVTFSHESDQSKPNYDQ
FT                   PTIRIAPVAPIVPVVPAAGPGTVPPAQRQQAQPVARKSKLRRIARRIVGPTILTKR"
     MNLHPRVGLP TRGWGDRSGY RHPFGKIAHV TFSHESDQSK PNYDQPTIRI APVAPIVPVV        60
     PAAGPGTVPP AQRQQAQPVA RKSKLRRIAR RIVGPTILTK R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page