(data stored in ACNUC7421 zone)

EMBL: CP001630.PE6

CP001630.PE6         Location/Qualifiers
FT   CDS             6701..8674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33980"
FT                   /db_xref="GOA:C6WCF9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF9"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACU33980.1"
FT                   /translation="MAAQKKDYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIQEV
FT                   VDNSVDEAMAGYASKVVVTLLANGGVRVVDDGRGIPVDLHPVEGKPTLEVVLTKLHAGG
FT                   KFDSDSYAVSGGLHGVGISVVNALSTAVDVEVKRQGFTWNQRFEASKPAHELQRGVPTS
FT                   ETGTTITFWADPTIFETTDYNIETISRRLQEMAFLNKGLSIVLRDERVAEEGAEEADAE
FT                   GHVAKVRERVFHYPGGLEDFVRHLNHTREAVHQKVVSFEAKGDDLEVEVAMQWNTGYTP
FT                   SVYTFANTINTHEGGTHEEGFRAALTRVVNEYARDKKLIKEKDANLTGDDIREGLAAII
FT                   SVKLKEPQFEGQTKTKLGNSEAKSFVQKSTNEHLADWFERHPNEAKTIITKAVSSSQAR
FT                   IAARKARELVRRKGALDIGGLPGKLKDCRSSNPEECEVYIVEGDSAGGSAKEGRDSMYQ
FT                   AILPIRGKIINVEKARIDRVLKNTEVQSIITAMGTGIHDEFDVSKLRYHKVVLMADADV
FT                   DGQHIRTLLLTLLFRFMRPLLEHGHVYLAQPPLYKIKWLRAEPEYAYSDRERDGLIEQG
FT                   LAAGKKIGKDDNIQRYKGLGEMNAEELWETTMDPANRVLLQVTMDDAAAADELFSVLMG
FT                   EDVEARRSFITRNAKGVRFLDV"
     MAAQKKDYGA SSITVLEGLE AVRKRPGMYI GSTGERGLHH LIQEVVDNSV DEAMAGYASK        60
     VVVTLLANGG VRVVDDGRGI PVDLHPVEGK PTLEVVLTKL HAGGKFDSDS YAVSGGLHGV       120
     GISVVNALST AVDVEVKRQG FTWNQRFEAS KPAHELQRGV PTSETGTTIT FWADPTIFET       180
     TDYNIETISR RLQEMAFLNK GLSIVLRDER VAEEGAEEAD AEGHVAKVRE RVFHYPGGLE       240
     DFVRHLNHTR EAVHQKVVSF EAKGDDLEVE VAMQWNTGYT PSVYTFANTI NTHEGGTHEE       300
     GFRAALTRVV NEYARDKKLI KEKDANLTGD DIREGLAAII SVKLKEPQFE GQTKTKLGNS       360
     EAKSFVQKST NEHLADWFER HPNEAKTIIT KAVSSSQARI AARKARELVR RKGALDIGGL       420
     PGKLKDCRSS NPEECEVYIV EGDSAGGSAK EGRDSMYQAI LPIRGKIINV EKARIDRVLK       480
     NTEVQSIITA MGTGIHDEFD VSKLRYHKVV LMADADVDGQ HIRTLLLTLL FRFMRPLLEH       540
     GHVYLAQPPL YKIKWLRAEP EYAYSDRERD GLIEQGLAAG KKIGKDDNIQ RYKGLGEMNA       600
     EELWETTMDP ANRVLLQVTM DDAAAADELF SVLMGEDVEA RRSFITRNAK GVRFLDV          657
//

If you have problems or comments...

PBIL Back to PBIL home page