(data stored in ACNUC7421 zone)

EMBL: CP001630.PE60

CP001630.PE60        Location/Qualifiers
FT   CDS             complement(70271..70696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0060"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mlo:mlr4254
FT                   osmotically inducible protein C, putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34034"
FT                   /db_xref="GOA:C6WDN9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN9"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACU34034.1"
FT                   /translation="MATVRKATTHWKGSLMEGDGTVTLESSGVGTYDVSWPSRAEQANG
FT                   KTSPEELIAAAHSSCYSMALSHGLAQAGTPPQQVDTSAEVTFKPGTGITGIHLTVRAVV
FT                   PGLEADAFAEAAETAKKNCPVSQALAAVEITLDAALA"
     MATVRKATTH WKGSLMEGDG TVTLESSGVG TYDVSWPSRA EQANGKTSPE ELIAAAHSSC        60
     YSMALSHGLA QAGTPPQQVD TSAEVTFKPG TGITGIHLTV RAVVPGLEAD AFAEAAETAK       120
     KNCPVSQALA AVEITLDAAL A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page