(data stored in ACNUC7421 zone)

EMBL: CP001630.PE61

CP001630.PE61        Location/Qualifiers
FT   CDS             complement(70942..71337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34035"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34035.1"
FT                   /translation="MADWRTRAASLLPELTAVVERESWSCHVFLTELWQLALDGHREDD
FT                   RDLLTRVYGFAHWCFRQEQFLANAAVVSFYEHVFDEWELRDAVAPWLPTEVVDKVRPLW
FT                   EWRWPQERLSEVDRLLSGSGTPGERAV"
     MADWRTRAAS LLPELTAVVE RESWSCHVFL TELWQLALDG HREDDRDLLT RVYGFAHWCF        60
     RQEQFLANAA VVSFYEHVFD EWELRDAVAP WLPTEVVDKV RPLWEWRWPQ ERLSEVDRLL       120
     SGSGTPGERA V                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page