(data stored in ACNUC7421 zone)

EMBL: CP001630.PE62

CP001630.PE62        Location/Qualifiers
FT   CDS             71534..73003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0062"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   afw:Anae109_0839 ECF subfamily RNA polymerase sigma-24
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34036"
FT                   /db_xref="GOA:C6WDP1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34036.1"
FT                   /translation="MAIGARLGLEVPGGMADEADVDLELLARVRAGDDAAFGELYSRHA
FT                   DAVRRFALRHVREHAEADDLAAEAFFRVLQAIRRGSGPTEHVRTYLLTTARRVAWEWSG
FT                   RRRDVPVEDEELSRRVEPFPDATAGRAEHTLISRAFTSLPERWRSVLWQVEVEGVRPSA
FT                   VAPAFGLSPNAMAALARRAREGLRAAYLQAHLADDRGPRACHSVVAKLGAYTAGGVQGA
FT                   EQARIRKHLRTCSSCNALHAELAEVCSALRAHAGLLAAPALLSLAFAPEVVAPVAGKVK
FT                   LALTAASVAAVGVFGVAAGALDGGPGPALVQPGPYALRTTVDDPLTPRPSVTLTGTATS
FT                   LPPAGDGAARPATSNRPSGGGGRGSLTGGDRVGPPTGAPPQSGGPQSGEPPTGGPPFGE
FT                   PASGEPGSGQSEPPATTSPTPGALEDPGTTALSTPDDPEQSGKEDPEPPGTTTTGQGPD
FT                   PEPGPSVLQSPELGITPTTVTLHPRTAYPVG"
     MAIGARLGLE VPGGMADEAD VDLELLARVR AGDDAAFGEL YSRHADAVRR FALRHVREHA        60
     EADDLAAEAF FRVLQAIRRG SGPTEHVRTY LLTTARRVAW EWSGRRRDVP VEDEELSRRV       120
     EPFPDATAGR AEHTLISRAF TSLPERWRSV LWQVEVEGVR PSAVAPAFGL SPNAMAALAR       180
     RAREGLRAAY LQAHLADDRG PRACHSVVAK LGAYTAGGVQ GAEQARIRKH LRTCSSCNAL       240
     HAELAEVCSA LRAHAGLLAA PALLSLAFAP EVVAPVAGKV KLALTAASVA AVGVFGVAAG       300
     ALDGGPGPAL VQPGPYALRT TVDDPLTPRP SVTLTGTATS LPPAGDGAAR PATSNRPSGG       360
     GGRGSLTGGD RVGPPTGAPP QSGGPQSGEP PTGGPPFGEP ASGEPGSGQS EPPATTSPTP       420
     GALEDPGTTA LSTPDDPEQS GKEDPEPPGT TTTGQGPDPE PGPSVLQSPE LGITPTTVTL       480
     HPRTAYPVG                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page