(data stored in ACNUC7421 zone)

EMBL: CP001630.PE63

CP001630.PE63        Location/Qualifiers
FT   CDS             73127..73564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34037"
FT                   /db_xref="GOA:C6WDP2"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34037.1"
FT                   /translation="MTRLVRGADGRMWTVRSQVEWRNPAADADFEHDVSGGQGPGVLML
FT                   AIVAAMGVLLVAWTPEQVVVPAWLGLALAMMFLFFPVRWAIRRPHLVVAESKATGDDLP
FT                   PERWVGHVRGVLNVRDEVGNIARKIEMYSLPDIDGPLQPVD"
     MTRLVRGADG RMWTVRSQVE WRNPAADADF EHDVSGGQGP GVLMLAIVAA MGVLLVAWTP        60
     EQVVVPAWLG LALAMMFLFF PVRWAIRRPH LVVAESKATG DDLPPERWVG HVRGVLNVRD       120
     EVGNIARKIE MYSLPDIDGP LQPVD                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page