(data stored in ACNUC7421 zone)

EMBL: CP001630.PE64

CP001630.PE64        Location/Qualifiers
FT   CDS             73786..75072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0064"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: signal transduction histidine
FT                   kinase, LytS; K07704 two-component system, LytT family,
FT                   sensor histidine kinase LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34038"
FT                   /db_xref="GOA:C6WDP3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP3"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACU34038.1"
FT                   /translation="MPGARRPHSMDGVRDLLTERAVLGVIATLAVLGLFVMLCRARRVS
FT                   TSVEDAVMDMLHRMSKASADLREGLTAEAADKATPHLREMLRCVAVGITDSTGSVLSWD
FT                   GGAADHYELMRGHIEQAIREVHKEHVEHRKLDCDLSGPCPMHSAVIVPLIVESEVAGTL
FT                   IVVSGVPNKRQIRMAEETARFVSTQLELEVLQKSRQALAQAEVRALRAQISPHFVYNAL
FT                   NTISSLIRTDPVYARELLQEFAEFTRYSFRTDGFFTTLSDELTNIHRYLTIEQARYGAR
FT                   LEVRLRIAPEVLQVVLPFLCLQPLVENAVRHGLAKKPGGGMLTITAEDNGAEALISVED
FT                   DGVGMDPERLFEDLKDAHQTGAHVGLGNINHRMRAVFGDDYALVVETAPEAGMKIILKV
FT                   PKYRQGVRPNLTLVAPRVEETGEQAVLRA"
     MPGARRPHSM DGVRDLLTER AVLGVIATLA VLGLFVMLCR ARRVSTSVED AVMDMLHRMS        60
     KASADLREGL TAEAADKATP HLREMLRCVA VGITDSTGSV LSWDGGAADH YELMRGHIEQ       120
     AIREVHKEHV EHRKLDCDLS GPCPMHSAVI VPLIVESEVA GTLIVVSGVP NKRQIRMAEE       180
     TARFVSTQLE LEVLQKSRQA LAQAEVRALR AQISPHFVYN ALNTISSLIR TDPVYARELL       240
     QEFAEFTRYS FRTDGFFTTL SDELTNIHRY LTIEQARYGA RLEVRLRIAP EVLQVVLPFL       300
     CLQPLVENAV RHGLAKKPGG GMLTITAEDN GAEALISVED DGVGMDPERL FEDLKDAHQT       360
     GAHVGLGNIN HRMRAVFGDD YALVVETAPE AGMKIILKVP KYRQGVRPNL TLVAPRVEET       420
     GEQAVLRA                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page