(data stored in ACNUC7421 zone)

EMBL: CP001630.PE66

CP001630.PE66        Location/Qualifiers
FT   CDS             75285..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0066"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rce:RC1_1672 proteinase
FT                   SohB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34040"
FT                   /db_xref="GOA:C6WDP5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP5"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACU34040.1"
FT                   /translation="MSVTDKIASRLPKIVGDRVDRGPVVAAVRLHGVITPNPGPVAARG
FT                   SLNAQSVESALTRAFEHERLVAVALLVNSPGGAPTQSALIADRVRELAAKRRVPVLAFC
FT                   EDVAASGGYWLACAADEIHAHPTSLVGSIGVVSSGFGLTGLMERFGVERRVHSAGESKV
FT                   RLDPFQPEKAEDVAWLEGLQSELHEQFKAWVTERRGRRLAADAPDLFAGEVWTGAKALE
FT                   LGLVDGLGTLRGVIGKRYPDAEIAIAEPRRNLLSRLGLGNAASTRSGDFVTQALASLEE
FT                   RARWSRFGL"
     MSVTDKIASR LPKIVGDRVD RGPVVAAVRL HGVITPNPGP VAARGSLNAQ SVESALTRAF        60
     EHERLVAVAL LVNSPGGAPT QSALIADRVR ELAAKRRVPV LAFCEDVAAS GGYWLACAAD       120
     EIHAHPTSLV GSIGVVSSGF GLTGLMERFG VERRVHSAGE SKVRLDPFQP EKAEDVAWLE       180
     GLQSELHEQF KAWVTERRGR RLAADAPDLF AGEVWTGAKA LELGLVDGLG TLRGVIGKRY       240
     PDAEIAIAEP RRNLLSRLGL GNAASTRSGD FVTQALASLE ERARWSRFGL                  290
//

If you have problems or comments...

PBIL Back to PBIL home page