(data stored in ACNUC7421 zone)

EMBL: CP001630.PE67

CP001630.PE67        Location/Qualifiers
FT   CDS             76254..77081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0067"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: LytTr DNA-binding region; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   gur:Gura_2791 LytTR family two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34041"
FT                   /db_xref="GOA:C6WDP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP6"
FT                   /inference="protein motif:PFAM:PF04397"
FT                   /protein_id="ACU34041.1"
FT                   /translation="MSSGLLVLAVDDEAPGLDEIKFLLESSPHIRRVLTAFDAAEALRI
FT                   LRGDYDTEVMERQEAGQPPVDAVFADINMPGLSGTDLARVLGAFRAPPALVFVTGVEHS
FT                   EAVVAFDVGAVDFVTKPINSDRVNKAIARVVDRVNSVSAAAAAPEPTAADSQDDEVIPV
FT                   ELGGTIKLVPRASVRYVEAQGDYARLHTNDGQSHLVRIPLAQLEERWENAGFVRIHRSF
FT                   LVALPLVTELRMTSNGYAVVIGSGEGAKELPVSRRHTRDLKERIVRPPKSNWG"
     MSSGLLVLAV DDEAPGLDEI KFLLESSPHI RRVLTAFDAA EALRILRGDY DTEVMERQEA        60
     GQPPVDAVFA DINMPGLSGT DLARVLGAFR APPALVFVTG VEHSEAVVAF DVGAVDFVTK       120
     PINSDRVNKA IARVVDRVNS VSAAAAAPEP TAADSQDDEV IPVELGGTIK LVPRASVRYV       180
     EAQGDYARLH TNDGQSHLVR IPLAQLEERW ENAGFVRIHR SFLVALPLVT ELRMTSNGYA       240
     VVIGSGEGAK ELPVSRRHTR DLKERIVRPP KSNWG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page