(data stored in ACNUC7421 zone)

EMBL: CP001630.PE68

CP001630.PE68        Location/Qualifiers
FT   CDS             77078..77500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34042"
FT                   /db_xref="GOA:C6WDP7"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34042.1"
FT                   /translation="MSEQPGPPAEQPAPGEHAPAQGRKPRRRRVVLADPKGRGRVLRTI
FT                   IELEEQTSVGEKLVRDLIRQQLRTAFVLGGGTLLAVALLPLLFYLVDLSEVQLFGVRLP
FT                   WLLLGLVPFPLFYLVGLLSRRQAERHERDFVSMVDR"
     MSEQPGPPAE QPAPGEHAPA QGRKPRRRRV VLADPKGRGR VLRTIIELEE QTSVGEKLVR        60
     DLIRQQLRTA FVLGGGTLLA VALLPLLFYL VDLSEVQLFG VRLPWLLLGL VPFPLFYLVG       120
     LLSRRQAERH ERDFVSMVDR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page