(data stored in ACNUC7421 zone)

EMBL: CP001630.PE69

CP001630.PE69        Location/Qualifiers
FT   CDS             77504..79315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0069"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: dac:Daci_5957 SSS
FT                   family solute/sodium (Na+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34043"
FT                   /db_xref="GOA:C6WDP8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP8"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACU34043.1"
FT                   /translation="MVQNLWSLSLVAVVAVVTFLLGYVGSRRANTTPDFLVARRAVPAT
FT                   RNAAAISGEYLSAASFLGVAGLILKDGVDALWYPIGFTAGYLAMMLFVAAPLRRSGAYT
FT                   LPDFAEARLGSRKLRHFCTFFVVCIGVLYLVPQLQSAGLTLNTITGLPAWLGGVLVTLI
FT                   VVANVLGGGMRAITLVQAFQYWGKLFAISAPTFVLFAVFLTGPGTSAQSVDAEGVLLFH
FT                   EPVTVTTVDPVRLEVTSLTKLHVVGEVDGARADGPAYWGPDSGGAPKTYSVAKGTELRF
FT                   TAGSPVPVVEGAPSANDVWLRPQTDGLGGLFETYSLIFATFLGTMGLPHVLVRFYTNPD
FT                   GKAARRTALHVLYLLGLFYVFPTVLGVISRLYLPQLLVTGKTDAAVLLLPHTMLPGVLG
FT                   QILGAVVAAGAFAAFLSTSSGLVVSVAGVVSTDILRGKVRDFRWATVLTGAVAIGLALL
FT                   LPRSDASLTVAMSFALAASTFCPLLLLGIWWRGLTWVGAVAGLVVGGGLVILSQVVTAV
FT                   SKATGDWAPALLAQPALVTVPIAFLTMIWISKLTGPSRPADVNQVLLRLHAPDRLGFMR
FT                   DRGARFASGGARRAGEGQHRGAAGSGG"
     MVQNLWSLSL VAVVAVVTFL LGYVGSRRAN TTPDFLVARR AVPATRNAAA ISGEYLSAAS        60
     FLGVAGLILK DGVDALWYPI GFTAGYLAMM LFVAAPLRRS GAYTLPDFAE ARLGSRKLRH       120
     FCTFFVVCIG VLYLVPQLQS AGLTLNTITG LPAWLGGVLV TLIVVANVLG GGMRAITLVQ       180
     AFQYWGKLFA ISAPTFVLFA VFLTGPGTSA QSVDAEGVLL FHEPVTVTTV DPVRLEVTSL       240
     TKLHVVGEVD GARADGPAYW GPDSGGAPKT YSVAKGTELR FTAGSPVPVV EGAPSANDVW       300
     LRPQTDGLGG LFETYSLIFA TFLGTMGLPH VLVRFYTNPD GKAARRTALH VLYLLGLFYV       360
     FPTVLGVISR LYLPQLLVTG KTDAAVLLLP HTMLPGVLGQ ILGAVVAAGA FAAFLSTSSG       420
     LVVSVAGVVS TDILRGKVRD FRWATVLTGA VAIGLALLLP RSDASLTVAM SFALAASTFC       480
     PLLLLGIWWR GLTWVGAVAG LVVGGGLVIL SQVVTAVSKA TGDWAPALLA QPALVTVPIA       540
     FLTMIWISKL TGPSRPADVN QVLLRLHAPD RLGFMRDRGA RFASGGARRA GEGQHRGAAG       600
     SGG                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page