(data stored in ACNUC7421 zone)

EMBL: CP001630.PE7

CP001630.PE7         Location/Qualifiers
FT   CDS             8721..11243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sus:Acid_3975 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33981"
FT                   /db_xref="GOA:C6WCG0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG0"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACU33981.1"
FT                   /translation="MSETTLPPIGGGSDRTEPRDLQQEMQNSYIDYAMSVIVGRALPDV
FT                   RDGLKPVHVRVLYSMFDSRFLPERSYNKCARVVGDVMGNYHPHGDSAIYDALVRLAQPW
FT                   AMRYPLIDGQGNFGSQGNDPAAAMRYTECRLTPLAMRMLADIEEDTVDFRDNYDGRIQE
FT                   PTVLPSRVPNLLINGSSGIAVGMATNIPPHNLREVAEGVVWALDNPEASDEETLEAMIA
FT                   RIKGPDFPTYGQILGTQGIEDAYRTGRGSVKMRAVVEMDEDAKGRTILVVSELPYQVNP
FT                   DNLVENIASLVRDQKINGISNIADESNRRSGMRIVVTVKRDAVAKVVLNNLYKHTQLQY
FT                   SFGVNMLSLVDGVPRTLRLDQMIRHYVKHQIEVIVRRTKFRLRKAEERAHVWRGLVKAL
FT                   DQLDAVIALIRRSDTTESARSGLMELLSVDEVQSNAILEMQLRRLAALERQKIIDQLAE
FT                   IELQIADLKDILAKPERQRAIVRGELLEIVDKHGDDRRTKIVPFDGDVSMEDLIAVEDV
FT                   VVTITRTGYAKRTKTDLYRAQKRGGKGVQGAQLKQDDIVQHFFVCSTHDWILFFTNKGR
FT                   VYRTKAYDLPEASRNARGQHVANLLAFQPDEEIAQVIQIKNYEAAPYLVLATRNGLVKK
FT                   SKLSDFDSNRSGGLIGINLREEDELVGAVLTGEGDDLLLVSKDGQSIRFHSSDDVLRPM
FT                   GRATSGVQGMRFNSDDELLSMGVVQEGLFVLVATDGGYAKRTPIEDYPVQGRGGKGVLT
FT                   IQHDRRRGRLVGALIVDVEDELYAITSAGGVIRTSAKEIRKAGRQTKGVRLMNLGEKST
FT                   LIAVARNADEPADVSTGEEDDQAIEPAN"
     MSETTLPPIG GGSDRTEPRD LQQEMQNSYI DYAMSVIVGR ALPDVRDGLK PVHVRVLYSM        60
     FDSRFLPERS YNKCARVVGD VMGNYHPHGD SAIYDALVRL AQPWAMRYPL IDGQGNFGSQ       120
     GNDPAAAMRY TECRLTPLAM RMLADIEEDT VDFRDNYDGR IQEPTVLPSR VPNLLINGSS       180
     GIAVGMATNI PPHNLREVAE GVVWALDNPE ASDEETLEAM IARIKGPDFP TYGQILGTQG       240
     IEDAYRTGRG SVKMRAVVEM DEDAKGRTIL VVSELPYQVN PDNLVENIAS LVRDQKINGI       300
     SNIADESNRR SGMRIVVTVK RDAVAKVVLN NLYKHTQLQY SFGVNMLSLV DGVPRTLRLD       360
     QMIRHYVKHQ IEVIVRRTKF RLRKAEERAH VWRGLVKALD QLDAVIALIR RSDTTESARS       420
     GLMELLSVDE VQSNAILEMQ LRRLAALERQ KIIDQLAEIE LQIADLKDIL AKPERQRAIV       480
     RGELLEIVDK HGDDRRTKIV PFDGDVSMED LIAVEDVVVT ITRTGYAKRT KTDLYRAQKR       540
     GGKGVQGAQL KQDDIVQHFF VCSTHDWILF FTNKGRVYRT KAYDLPEASR NARGQHVANL       600
     LAFQPDEEIA QVIQIKNYEA APYLVLATRN GLVKKSKLSD FDSNRSGGLI GINLREEDEL       660
     VGAVLTGEGD DLLLVSKDGQ SIRFHSSDDV LRPMGRATSG VQGMRFNSDD ELLSMGVVQE       720
     GLFVLVATDG GYAKRTPIED YPVQGRGGKG VLTIQHDRRR GRLVGALIVD VEDELYAITS       780
     AGGVIRTSAK EIRKAGRQTK GVRLMNLGEK STLIAVARNA DEPADVSTGE EDDQAIEPAN       840
//

If you have problems or comments...

PBIL Back to PBIL home page