(data stored in ACNUC7421 zone)

EMBL: CP001630.PE70

CP001630.PE70        Location/Qualifiers
FT   CDS             79609..79965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0070"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   gme:Gmet_3287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34044"
FT                   /db_xref="GOA:C6WDP9"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP9"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACU34044.1"
FT                   /translation="MSTTEDSAGPTPGSPDSTDWVAVQSSPEFTELRRRLRTFVFPMAG
FT                   LFLTWYVLYVLLADYAHGFMSTKLVGNINVGLVLGLLQFVSTFAITALYVRHANRNLDP
FT                   TAEKIRHELEGGDA"
     MSTTEDSAGP TPGSPDSTDW VAVQSSPEFT ELRRRLRTFV FPMAGLFLTW YVLYVLLADY        60
     AHGFMSTKLV GNINVGLVLG LLQFVSTFAI TALYVRHANR NLDPTAEKIR HELEGGDA         118
//

If you have problems or comments...

PBIL Back to PBIL home page