(data stored in ACNUC7421 zone)

EMBL: CP001630.PE71

CP001630.PE71        Location/Qualifiers
FT   CDS             79962..81548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0071"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bca:BCE_1726
FT                   sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34045"
FT                   /db_xref="GOA:C6WDQ0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ0"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACU34045.1"
FT                   /translation="MNTNAVLNIGIFGLFVAATLVVVIRASRNTKTAADYLAAGRAFTG
FT                   PQNGIAIAGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVALLLVAELLRNTGKY
FT                   TMGDVLSFRMRQRPVRAAAATSTMVVSFFYLLAQMAGAGGLVALLLGITGKGGQAIVIA
FT                   VVGALMIAYVLIGGMKGTTWVQIIKAVLLIVGAGVMTIWVLAKYGFNLSTLLGAAVDNA
FT                   PKAGEKLLGPGLQYGATGTTKLDFLSLGLALVLGTAGLPHILMRFYTVPTAKEARRSVV
FT                   WAIWLIGLFYLFTLVLGYGAAALVGPDKINAAPGKANSAAPLLAEAIGGPLLLGLIAAV
FT                   AFATILAVVAGLTITASASFAHDIYANVIKKGEVEDKDAEVRVARRTAIVIGVVSILGG
FT                   IAANGQNVAFLVALAFAVAASANLPTILYSLFWKRFNTAGALWSIYGGLSVTLVLIVLS
FT                   PAVSGRPTSMFPTMDFDLFPLSNPGIISIPLAFLLGYLGTVLSKERNPAKYAEMEVRAL
FT                   TGTGAEKATSH"
     MNTNAVLNIG IFGLFVAATL VVVIRASRNT KTAADYLAAG RAFTGPQNGI AIAGDYLSAA        60
     SFLGIAGAIA VYGYDGFLYS IGFLVAWLVA LLLVAELLRN TGKYTMGDVL SFRMRQRPVR       120
     AAAATSTMVV SFFYLLAQMA GAGGLVALLL GITGKGGQAI VIAVVGALMI AYVLIGGMKG       180
     TTWVQIIKAV LLIVGAGVMT IWVLAKYGFN LSTLLGAAVD NAPKAGEKLL GPGLQYGATG       240
     TTKLDFLSLG LALVLGTAGL PHILMRFYTV PTAKEARRSV VWAIWLIGLF YLFTLVLGYG       300
     AAALVGPDKI NAAPGKANSA APLLAEAIGG PLLLGLIAAV AFATILAVVA GLTITASASF       360
     AHDIYANVIK KGEVEDKDAE VRVARRTAIV IGVVSILGGI AANGQNVAFL VALAFAVAAS       420
     ANLPTILYSL FWKRFNTAGA LWSIYGGLSV TLVLIVLSPA VSGRPTSMFP TMDFDLFPLS       480
     NPGIISIPLA FLLGYLGTVL SKERNPAKYA EMEVRALTGT GAEKATSH                    528
//

If you have problems or comments...

PBIL Back to PBIL home page