(data stored in ACNUC7421 zone)

EMBL: CP001630.PE72

CP001630.PE72        Location/Qualifiers
FT   CDS             81691..82116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0072"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: maq:Maqu_3385 DNA binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34046"
FT                   /db_xref="GOA:C6WDQ1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ1"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU34046.1"
FT                   /translation="MGATERDVLFANEVNQRQAQELIGLLSGRNARFTAESDGGGAARQ
FT                   VPAELSGLIAKLVHAVARGQAVTVTTMPEELTTTAAAQLLGISRPTLMRKVNAGEIPSR
FT                   KVGAHTRLRTEDVLRERRERRQRQLAALDELRDLEEF"
     MGATERDVLF ANEVNQRQAQ ELIGLLSGRN ARFTAESDGG GAARQVPAEL SGLIAKLVHA        60
     VARGQAVTVT TMPEELTTTA AAQLLGISRP TLMRKVNAGE IPSRKVGAHT RLRTEDVLRE       120
     RRERRQRQLA ALDELRDLEE F                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page