(data stored in ACNUC7421 zone)

EMBL: CP001630.PE73

CP001630.PE73        Location/Qualifiers
FT   CDS             82184..82774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34047"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34047.1"
FT                   /translation="MKVLADANVLYSRTLLDWFGLLQGSDEQQVYHAYWTEDLLAEALF
FT                   HLRRDKPALDGGQISSIRDKIEKAFEGGRVDDFVIDDSFPGKDVNDRHVHAAAVTCQAD
FT                   IVLTCDEGFHSEQVADLLPYEVHKPDEFFVLVHDIAPEIVWQATLKQTRYWVGRGKRAD
FT                   LFDRLVKAGCPEFAARVQVHQSRLSLPHDTTRP"
     MKVLADANVL YSRTLLDWFG LLQGSDEQQV YHAYWTEDLL AEALFHLRRD KPALDGGQIS        60
     SIRDKIEKAF EGGRVDDFVI DDSFPGKDVN DRHVHAAAVT CQADIVLTCD EGFHSEQVAD       120
     LLPYEVHKPD EFFVLVHDIA PEIVWQATLK QTRYWVGRGK RADLFDRLVK AGCPEFAARV       180
     QVHQSRLSLP HDTTRP                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page